Text mining Term | cytochrome c |
---|---|
UniProt ID | COX5C_IPOBA |
Name |
Cytochrome c oxidase subunit 5C Cytochrome c oxidase polypeptide Vc |
Gene Names |
COX5C
Synonyms:COXVC |
Taxonomy | Ipomoea batatas |
Function |
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. |
---|---|
Subcellular location |
Mitochondrion inner membrane. |
GO:0016021 | integral to membrane | CC |
GO:0005746 | mitochondrial respiratory chain | CC |
>gi|688313|gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas] MAGGHVAHLVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVVADEE |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |