Text mining Term | cytochrome c |
---|---|
UniProt ID | Q6S4N3_HELAN |
Name |
Cytochrome c |
Gene Names |
|
Taxonomy | Helianthus annuus |
Function |
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity). |
---|---|
Subcellular location |
GO:0009055 | electron carrier activity | MF |
GO:0070469 | respiratory chain | CC |
GO:0006810 | transport | BP |
GO:0020037 | heme binding | MF |
GO:0022900 | electron transport chain | BP |
GO:0005739 | mitochondrion | CC |
>gi|39777372|gb|AAR30955.1| cytochrome c [Helianthus annuus] MASFAEAPAGNPTTGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAGNKNKAVIWEE NTLYDYLLNPKKYIPGTKMVFPGPKKPQERADLIAYLKTSTA |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF00034 |