Text mining Term | cullin |
---|---|
UniProt ID | CSN5B_BRAOL |
Name |
COP9 signalosome complex subunit 5b Jun activation domain-binding homolog 1 Signalosome subunit 5b |
Gene Names |
CSN5B
Synonyms:AJH1 |
Taxonomy | Brassica oleracea |
Function |
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1- containing Ubl ligase complexes (By similarity). |
---|---|
Subcellular location |
Cytoplasm. Nucleus. |
GO:0008180 | signalosome | CC |
GO:0007275 | multicellular organismal development | BP |
GO:0009585 | red, far-red light phototransduction | BP |
GO:0005737 | cytoplasm | CC |
GO:0046872 | metal ion binding | MF |
GO:0006508 | proteolysis | BP |
GO:0008237 | metallopeptidase activity | MF |
>gi|55976235|sp|P68355.1|CSN5B_BRAOL RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome subunit 5b; AltName: Full=Jun activation domain-binding homolog 1 VEQPDSSSSDGIFYYDEASQTKKISDDHVSEYQTIPLNKKQYYSLDITYFKSSLDSHLLDLLWNKKDILF NSARQSDK |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |