Text mining Term | caspase 3 |
---|---|
UniProt ID | CASP3_MOUSE |
Name |
SCA-1 Cysteine protease CPP32 SREBP cleavage activity 1 CPP-32 Caspase-3 subunit p17 LICE Caspase-3 Caspase-3 subunit p12 Apopain Protein Yama CASP-3 |
Gene Names |
Casp3
Synonyms:Cpp32 |
Taxonomy | Mus musculus |
Function |
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop- helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9 (By similarity). Cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. |
---|---|
Subcellular location |
Cytoplasm. |
GO:0008625 | induction of apoptosis via death domain receptors | BP |
GO:0006309 | DNA fragmentation involved in apoptotic nuclear change | BP |
GO:0001836 | release of cytochrome c from mitochondria | BP |
GO:0046007 | negative regulation of activated T cell proliferation | BP |
GO:0008631 | induction of apoptosis by oxidative stress | BP |
GO:0016485 | protein processing | BP |
GO:0043029 | T cell homeostasis | BP |
GO:0007507 | heart development | BP |
GO:0007605 | sensory perception of sound | BP |
GO:0030216 | keratinocyte differentiation | BP |
GO:0051402 | neuron apoptosis | BP |
GO:0009611 | response to wounding | BP |
GO:0005515 | protein binding | MF |
GO:0004861 | cyclin-dependent protein kinase inhibitor activity | MF |
GO:0045165 | cell fate commitment | BP |
GO:0043525 | positive regulation of neuron apoptosis | BP |
GO:0004197 | cysteine-type endopeptidase activity | MF |
GO:0004190 | aspartic-type endopeptidase activity | MF |
GO:0030889 | negative regulation of B cell proliferation | BP |
GO:0001782 | B cell homeostasis | BP |
GO:0009411 | response to UV | BP |
GO:0045736 | negative regulation of cyclin-dependent protein kinase activity | BP |
GO:0006974 | response to DNA damage stimulus | BP |
>gi|6753284|ref|NP_033940.1| caspase-3 [Mus musculus] MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVD AANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLT SFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSK DGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH |
Ensembl Gene |
ENSMUST00000093517 |
---|---|
UniGene |
Mm.34405 |
PDB | |
RefSeq |
NP_033940.1 |
Pfam |
PF00656 |