Text mining Term | caspase 3 |
---|---|
UniProt ID | CASP3_RAT |
Name |
SCA-1 Caspase-3 subunit p17 Caspase-3 subunit p12 LICE IRP Caspase-3 SREBP cleavage activity 1 Protein Yama Apopain Cysteine protease CPP32 CPP-32 CASP-3 |
Gene Names |
Casp3
Synonyms:Cpp32 |
Taxonomy | Rattus norvegicus |
Function |
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop- helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9 (By similarity). |
---|---|
Subcellular location |
Cytoplasm. |
GO:0032025 | response to cobalt ion | BP |
GO:0006508 | proteolysis | BP |
GO:0030182 | neuron differentiation | BP |
GO:0005829 | cytosol | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0043200 | response to amino acid stimulus | BP |
GO:0046677 | response to antibiotic | BP |
GO:0007611 | learning or memory | BP |
GO:0016005 | phospholipase A2 activator activity | MF |
GO:0004197 | cysteine-type endopeptidase activity | MF |
GO:0035556 | intracellular signal transduction | BP |
GO:0042060 | wound healing | BP |
GO:0034349 | glial cell apoptosis | BP |
GO:0021766 | hippocampus development | BP |
GO:0005625 | soluble fraction | CC |
GO:0035094 | response to nicotine | BP |
GO:0001666 | response to hypoxia | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0032355 | response to estradiol stimulus | BP |
GO:0042493 | response to drug | BP |
GO:0043525 | positive regulation of neuron apoptosis | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0006917 | induction of apoptosis | BP |
GO:0009749 | response to glucose stimulus | BP |
GO:0005515 | protein binding | MF |
GO:0010165 | response to X-ray | BP |
>gi|6978605|ref|NP_037054.1| caspase-3 [Rattus norvegicus] MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVD AANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLT SFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSR DGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH |
Ensembl Gene |
ENSRNOT00000014095 |
---|---|
UniGene |
Rn.10562 |
PDB | |
RefSeq |
NP_037054.1 |
Pfam |
PF00656 |