orexin

General Information (Source: NCBI Gene,UniProt)

Text mining Term	orexin
UniProt ID	OREX_RAT
Name	Orexin-B Hcrt Hcrt2 Hypocretin Hypocretin-2 Hypocretin-1 Orexin-A Orexin Hcrt1
Gene Names	Hcrt
Taxonomy	Rattus norvegicus

General annotation

Function	Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. A modulation effect on luteinizing hormone-releasing hormone (LHRH) secretion also suggests a more minor contribution to the regulation of reproductive function. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity.
Subcellular location	Rough endoplasmic reticulum. Note=Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses.

Function

Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. A modulation effect on luteinizing hormone-releasing hormone (LHRH) secretion also suggests a more minor contribution to the regulation of reproductive function. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity.

Subcellular location

Rough endoplasmic reticulum. Note=Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses.

Gene Ontology

GO:0042755	eating behavior	BP
GO:0008156	negative regulation of DNA replication	BP
GO:0051971	positive regulation of transmission of nerve impulse	BP
GO:0007200	activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger	BP
GO:0007204	elevation of cytosolic calcium ion concentration	BP
GO:0060079	regulation of excitatory postsynaptic membrane potential	BP
GO:0046928	regulation of neurotransmitter secretion	BP
GO:0043267	negative regulation of potassium ion transport	BP
GO:0005791	rough endoplasmic reticulum	CC
GO:0001662	behavioral fear response	BP
GO:0051928	positive regulation of calcium ion transport	BP
GO:0005184	neuropeptide hormone activity	MF
GO:0051970	negative regulation of transmission of nerve impulse	BP
GO:0031771	type 1 hypocretin receptor binding	MF
GO:0007205	activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway	BP
GO:0031772	type 2 hypocretin receptor binding	MF
GO:0007218	neuropeptide signaling pathway	BP
GO:0030141	secretory granule	CC

Sequence

>gi|6981016|ref|NP_037311.1| orexin precursor [Rattus norvegicus]
MNLPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRP
GPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPYPCPGRRCPTATATALAPRGGSRV

Database Cross Reference

Ensembl Gene	ENSRNOT00000025547
UniGene	Rn.7628
PDB
RefSeq	NP_037311.1
Pfam	PF02072

PTID

orexin

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference