Text mining Term | orexin |
---|---|
UniProt ID | OREX_RAT |
Name |
Hypocretin-1 Orexin-B Hypocretin Hcrt1 Hypocretin-2 Orexin-A Hcrt Hcrt2 Orexin |
Gene Names |
Hcrt
|
Taxonomy | Rattus norvegicus |
Function |
Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. A modulation effect on luteinizing hormone-releasing hormone (LHRH) secretion also suggests a more minor contribution to the regulation of reproductive function. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. |
---|---|
Subcellular location |
Rough endoplasmic reticulum. Note=Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. |
GO:0001662 | behavioral fear response | BP |
GO:0007218 | neuropeptide signaling pathway | BP |
GO:0005791 | rough endoplasmic reticulum | CC |
GO:0007200 | activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger | BP |
GO:0031772 | type 2 hypocretin receptor binding | MF |
GO:0008156 | negative regulation of DNA replication | BP |
GO:0005184 | neuropeptide hormone activity | MF |
GO:0051971 | positive regulation of transmission of nerve impulse | BP |
GO:0043267 | negative regulation of potassium ion transport | BP |
GO:0030141 | secretory granule | CC |
GO:0051928 | positive regulation of calcium ion transport | BP |
GO:0046928 | regulation of neurotransmitter secretion | BP |
GO:0031771 | type 1 hypocretin receptor binding | MF |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0042755 | eating behavior | BP |
GO:0007205 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | BP |
GO:0051970 | negative regulation of transmission of nerve impulse | BP |
GO:0007204 | elevation of cytosolic calcium ion concentration | BP |
>gi|6981016|ref|NP_037311.1| orexin precursor [Rattus norvegicus] MNLPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRP GPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPYPCPGRRCPTATATALAPRGGSRV |
Ensembl Gene |
ENSRNOT00000025547 |
---|---|
UniGene |
Rn.7628 |
PDB | |
RefSeq |
NP_037311.1 |
Pfam |
PF02072 |