cyclooxygenase 2

General Information (Source: NCBI Gene,UniProt)

Text mining Term cyclooxygenase 2
UniProt ID PGH2_RAT
Name COX-2
Prostaglandin G/H synthase 2
PGH synthase 2
Prostaglandin H2 synthase 2
Cyclooxygenase-2
PGHS-2
PHS II
Prostaglandin-endoperoxide synthase 2
Gene Names Ptgs2
Taxonomy Rattus norvegicus

General annotation

Function Mediates the formation of prostaglandins from arachidonate. May have a role as a major mediator of inflammation and/or a role for prostanoid signaling in activity-dependent plasticity (By similarity).
Subcellular location Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.

Gene Ontology

GO:0009314 response to radiation BP
GO:0005789 endoplasmic reticulum membrane CC
GO:0032355 response to estradiol stimulus BP
GO:0007613 memory BP
GO:0031915 positive regulation of synaptic plasticity BP
GO:0051384 response to glucocorticoid stimulus BP
GO:0008289 lipid binding MF
GO:0006979 response to oxidative stress BP
GO:0043234 protein complex CC
GO:0004601 peroxidase activity MF
GO:0032227 negative regulation of synaptic transmission, dopaminergic BP
GO:0071260 cellular response to mechanical stimulus BP
GO:0030282 bone mineralization BP
GO:0090362 positive regulation of platelet-derived growth factor production BP
GO:0010575 positive regulation vascular endothelial growth factor production BP
GO:0030728 ovulation BP
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis BP
GO:0008285 negative regulation of cell proliferation BP
GO:0042493 response to drug BP
GO:0032496 response to lipopolysaccharide BP
GO:0051968 positive regulation of synaptic transmission, glutamatergic BP
GO:0034097 response to cytokine stimulus BP
GO:0008217 regulation of blood pressure BP
GO:0045986 negative regulation of smooth muscle contraction BP
GO:0031622 positive regulation of fever generation BP
GO:0048661 positive regulation of smooth muscle cell proliferation BP
GO:0090271 positive regulation of fibroblast growth factor production BP
GO:0014070 response to organic cyclic compound BP
GO:0071318 cellular response to ATP BP
GO:0045907 positive regulation of vasoconstriction BP
GO:0010042 response to manganese ion BP
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen MF
GO:0046697 decidualization BP
GO:0043065 positive regulation of apoptotic process BP
GO:0033280 response to vitamin D BP
GO:0051926 negative regulation of calcium ion transport BP
GO:0051726 regulation of cell cycle BP
GO:0006954 inflammatory response BP
GO:0007566 embryo implantation BP
GO:0009750 response to fructose stimulus BP
GO:0005635 nuclear envelope CC
GO:0010243 response to organic nitrogen BP
GO:0020037 heme binding MF
GO:0042346 positive regulation of NF-kappaB import into nucleus BP
GO:0005792 microsome CC
GO:0045987 positive regulation of smooth muscle contraction BP
GO:0004666 prostaglandin-endoperoxide synthase activity MF
GO:0045429 positive regulation of nitric oxide biosynthetic process BP
GO:0035148 tube formation BP
GO:0071636 positive regulation of transforming growth factor beta production BP

Sequence

>gi|148747270|ref|NP_058928.3| prostaglandin G/H synthase 2 precursor [Rattus norvegicus]
MLFRAVLLCAALALSHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPT
PNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPP
VADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGTNMMFAFFAQHFTHQFFKTDQKRGPGFTRGL
GHGVDLNHVYGETLDRQHKLRLFQDGKLKYQVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVFGL
VPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYHDIDAMELY
PALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFRIINTASIQSLICNNVKG
CPFASFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000003567
UniGene Rn.44369
PDB
RefSeq NP_058928.3
Pfam PF03098