Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 Heme oxygenase 1 HSP32 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0001666 | response to hypoxia | BP |
GO:0006788 | heme oxidation | BP |
GO:0020037 | heme binding | MF |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0008219 | cell death | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0042167 | heme catabolic process | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0005829 | cytosol | CC |
GO:0005792 | microsome | CC |
GO:0019899 | enzyme binding | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0001525 | angiogenesis | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005730 | nucleolus | CC |
GO:0006644 | phospholipid metabolic process | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0005901 | caveola | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
3I9T 2ZVU 1IVJ 1IX3 2E7E 1IX4 1DVE 1UBB 1ULX 2DY5 1J02 1DVG 1IRM 1J2C 3I9U 1VGI |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |