Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 HSP32 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0001666 | response to hypoxia | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0019899 | enzyme binding | MF |
GO:0006644 | phospholipid metabolic process | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0001525 | angiogenesis | BP |
GO:0005829 | cytosol | CC |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0020037 | heme binding | MF |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0042167 | heme catabolic process | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0005730 | nucleolus | CC |
GO:0031670 | cellular response to nutrient | BP |
GO:0006788 | heme oxidation | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0005792 | microsome | CC |
GO:0008219 | cell death | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1DVG 1IX3 1IVJ 3I9U 1ULX 3I9T 2ZVU 1J02 1IX4 1UBB 1IRM 2E7E 1DVE 1J2C 2DY5 1VGI |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |