Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0001525 | angiogenesis | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0006788 | heme oxidation | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0020037 | heme binding | MF |
GO:0043627 | response to estrogen stimulus | BP |
GO:0019899 | enzyme binding | MF |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005730 | nucleolus | CC |
GO:0042167 | heme catabolic process | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0008219 | cell death | BP |
GO:0005792 | microsome | CC |
GO:0005829 | cytosol | CC |
GO:0031670 | cellular response to nutrient | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1J02 1ULX 3I9T 1IX4 1DVG 3I9U 1IVJ 2E7E 1DVE 2DY5 1IRM 2ZVU 1IX3 1VGI 1UBB 1J2C |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |