Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HO-1 HSP32 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0043627 | response to estrogen stimulus | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0008219 | cell death | BP |
GO:0001525 | angiogenesis | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0020037 | heme binding | MF |
GO:0006644 | phospholipid metabolic process | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0019899 | enzyme binding | MF |
GO:0031670 | cellular response to nutrient | BP |
GO:0042167 | heme catabolic process | BP |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0005829 | cytosol | CC |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0001666 | response to hypoxia | BP |
GO:0005792 | microsome | CC |
GO:0006788 | heme oxidation | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0005730 | nucleolus | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IX3 1J02 1DVG 1VGI 1IRM 2DY5 2ZVU 1J2C 1UBB 3I9U 1DVE 1IVJ 1ULX 1IX4 2E7E 3I9T |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |