Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0001525 | angiogenesis | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0005730 | nucleolus | CC |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0006788 | heme oxidation | BP |
GO:0042167 | heme catabolic process | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0019899 | enzyme binding | MF |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0005792 | microsome | CC |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0020037 | heme binding | MF |
GO:0005829 | cytosol | CC |
GO:0005783 | endoplasmic reticulum | CC |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0001666 | response to hypoxia | BP |
GO:0008219 | cell death | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1J02 1UBB 2ZVU 1IVJ 1IRM 1J2C 1IX4 3I9U 2DY5 1DVG 1IX3 3I9T 2E7E 1DVE 1ULX 1VGI |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |