Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0031670 | cellular response to nutrient | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0001525 | angiogenesis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0042167 | heme catabolic process | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0005730 | nucleolus | CC |
GO:0004630 | phospholipase D activity | MF |
GO:0006788 | heme oxidation | BP |
GO:0019899 | enzyme binding | MF |
GO:0008219 | cell death | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005792 | microsome | CC |
GO:0005829 | cytosol | CC |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0020037 | heme binding | MF |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0001666 | response to hypoxia | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1UBB 2E7E 1VGI 2ZVU 1ULX 3I9T 1DVE 1J2C 1IX4 1IX3 1IVJ 2DY5 1IRM 1J02 3I9U 1DVG |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |