Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005792 | microsome | CC |
GO:0008217 | regulation of blood pressure | BP |
GO:0020037 | heme binding | MF |
GO:0005730 | nucleolus | CC |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0019899 | enzyme binding | MF |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0005829 | cytosol | CC |
GO:0006788 | heme oxidation | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0001525 | angiogenesis | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0008219 | cell death | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0042167 | heme catabolic process | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IVJ 1J2C 2DY5 3I9T 1DVE 1IX4 1J02 3I9U 1DVG 2ZVU 1IX3 1IRM 1UBB 1ULX 1VGI 2E7E |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |