Text mining Term | CB1 |
---|---|
UniProt ID | CNR1_RAT |
Name |
Brain-type cannabinoid receptor CB1 CB-R Cannabinoid receptor 1 |
Gene Names |
Cnr1
Synonyms:Skr6 |
Taxonomy | Rattus norvegicus |
Function |
Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. |
---|---|
Subcellular location |
Cell membrane; Multi-pass membrane protein. |
GO:0031999 | negative regulation of fatty acid beta-oxidation | BP |
GO:0043271 | negative regulation of ion transport | BP |
GO:0019233 | sensory perception of pain | BP |
GO:0045471 | response to ethanol | BP |
GO:0042220 | response to cocaine | BP |
GO:0050796 | regulation of insulin secretion | BP |
GO:0045777 | positive regulation of blood pressure | BP |
GO:0033602 | negative regulation of dopamine secretion | BP |
GO:0004949 | cannabinoid receptor activity | MF |
GO:0033004 | negative regulation of mast cell activation | BP |
GO:0051001 | negative regulation of nitric-oxide synthase activity | BP |
GO:0051966 | regulation of synaptic transmission, glutamatergic | BP |
GO:0005515 | protein binding | MF |
GO:0060405 | regulation of penile erection | BP |
GO:0007584 | response to nutrient | BP |
GO:0010976 | positive regulation of neuron projection development | BP |
GO:0045759 | negative regulation of action potential | BP |
GO:0006950 | response to stress | BP |
GO:0016021 | integral to membrane | CC |
GO:0007188 | G-protein signaling, coupled to cAMP nucleotide second messenger | BP |
GO:0045776 | negative regulation of blood pressure | BP |
GO:0007283 | spermatogenesis | BP |
GO:0043278 | response to morphine | BP |
GO:0008144 | drug binding | MF |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0032228 | regulation of synaptic transmission, GABAergic | BP |
GO:0002866 | positive regulation of acute inflammatory response to antigenic stimulus | BP |
GO:0007613 | memory | BP |
GO:0005886 | plasma membrane | CC |
GO:0007568 | aging | BP |
GO:0043065 | positive regulation of apoptotic process | BP |
GO:0035094 | response to nicotine | BP |
GO:0060135 | maternal process involved in female pregnancy | BP |
GO:0031622 | positive regulation of fever generation | BP |
GO:0060259 | regulation of feeding behavior | BP |
>gi|6978673|ref|NP_036916.1| cannabinoid receptor 1 [Rattus norvegicus] MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPL VPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLC VILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFL TAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFW IGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLIL VVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Ensembl Gene |
ENSRNOT00000010850 |
---|---|
UniGene |
Rn.89774 |
PDB | |
RefSeq |
NP_036916.1 |
Pfam |
PF00001 |