angiotensin II

General Information (Source: NCBI Gene,UniProt)

Text mining Term angiotensin II
UniProt ID ANGT_RAT
Name Angiotensin-1
Serpin A8
Angiotensin III
Ang II
Angiotensin-2
Angiotensin II
Ang I
Angiotensinogen
Angiotensin-3
Ang III
Des-Asp[1]-angiotensin II
Angiotensin I
Gene Names Agt
Synonyms:Serpina8
Taxonomy Rattus norvegicus

General annotation

Function Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis (By similarity). In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10) (By similarity). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8) (By similarity). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8) (By similarity). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin) (By similarity). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2 (By similarity). Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone (By similarity). Angiotensin-3 stimulates aldosterone release (By similarity). Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
Subcellular location Secreted.

Gene Ontology

GO:0003331 positive regulation of extracellular matrix constituent secretion BP
GO:0034104 negative regulation of tissue remodeling BP
GO:0031702 type 1 angiotensin receptor binding MF
GO:0003051 angiotensin-mediated drinking behavior BP
GO:0071260 cellular response to mechanical stimulus BP
GO:0048144 fibroblast proliferation BP
GO:0048146 positive regulation of fibroblast proliferation BP
GO:0004937 alpha1-adrenergic receptor activity MF
GO:0050663 cytokine secretion BP
GO:0014824 artery smooth muscle contraction BP
GO:0051403 stress-activated MAPK cascade BP
GO:0035815 positive regulation of renal sodium excretion BP
GO:0048659 smooth muscle cell proliferation BP
GO:0007202 activation of phospholipase C activity BP
GO:0014061 regulation of norepinephrine secretion BP
GO:0048169 regulation of long-term neuronal synaptic plasticity BP
GO:0032930 positive regulation of superoxide anion generation BP
GO:0006883 cellular sodium ion homeostasis BP
GO:0044444 cytoplasmic part CC
GO:0002018 renin-angiotensin regulation of aldosterone production BP
GO:0031703 type 2 angiotensin receptor binding MF
GO:0051929 positive regulation of calcium ion transport via voltage-gated calcium channel activity BP
GO:0042311 vasodilation BP
GO:0004867 serine-type endopeptidase inhibitor activity MF
GO:0030162 regulation of proteolysis BP
GO:0005179 hormone activity MF
GO:0006917 induction of apoptosis BP
GO:0030308 negative regulation of cell growth BP
GO:0035411 catenin import into nucleus BP
GO:0007568 aging BP
GO:0005615 extracellular space CC
GO:0010613 positive regulation of cardiac muscle hypertrophy BP
GO:0070371 ERK1 and ERK2 cascade BP
GO:0061049 cell growth involved in cardiac muscle cell development BP
GO:0014873 response to muscle activity involved in regulation of muscle adaptation BP

Sequence

>gi|19705570|ref|NP_602308.1| angiotensinogen precursor [Rattus norvegicus]
MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYYSKSTCAQLENPSVETLPEPTFEPVPIQAKTSPV
DEKTLRDKLVLATEKLEAEDRQRAAQVAMIANFMGFRMYKMLSEARGVASGAVLSPPALFGTLVSFYLGS
LDPTASQLQVLLGVPVKEGDCTSRLDGHKVLTALQAVQGLLVTQGGSSSQTPLLQSTVVGLFTAPGLRLK
QPFVESLGPFTPAIFPRSLDLSTDPVLAAQKINRFVQAVTGWKMNLPLEGVSTDSTLFFNTYVHFQGKMR
GFSQLTGLHEFWVDNSTSVSVPMLSGTGNFQHWSDAQNNFSVTRVPLGESVTLLLIQPQCASDLDRVEVL
VFQHDFLTWIKNPPPRAIRLTLPQLEIRGSYNLQDLLAQAKLSTLLGAEANLGKMGDTNPRVGEVLNSIL
LELQAGEEEQPTESAQQPGSPEVLDVTLSSPFLFAIYERDSGALHFLGRVDNPQNVV

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000024917
UniGene Rn.6319
PDB 2WY1
2WXZ
1SMR
RefSeq NP_602308.1
Pfam PF00079