angiotensin II

General Information (Source: NCBI Gene,UniProt)

Text mining Term	angiotensin II
UniProt ID	ANGT_RAT
Name	Serpin A8 Angiotensin-3 Angiotensin I Angiotensin III Ang I Angiotensinogen Des-Asp[1]-angiotensin II Ang III Angiotensin II Ang II Angiotensin-2 Angiotensin-1
Gene Names	Agt Synonyms:Serpina8
Taxonomy	Rattus norvegicus

General annotation

Function	Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis (By similarity). In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10) (By similarity). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8) (By similarity). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8) (By similarity). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin) (By similarity). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2 (By similarity). Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone (By similarity). Angiotensin-3 stimulates aldosterone release (By similarity). Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
Subcellular location	Secreted.

Function

Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis (By similarity). In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10) (By similarity). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8) (By similarity). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8) (By similarity). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin) (By similarity). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2 (By similarity). Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone (By similarity). Angiotensin-3 stimulates aldosterone release (By similarity). Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.

Subcellular location

Secreted.

Gene Ontology

GO:0034104	negative regulation of tissue remodeling	BP
GO:0030308	negative regulation of cell growth	BP
GO:0014061	regulation of norepinephrine secretion	BP
GO:0030162	regulation of proteolysis	BP
GO:0003051	angiotensin-mediated drinking behavior	BP
GO:0002018	renin-angiotensin regulation of aldosterone production	BP
GO:0007568	aging	BP
GO:0010613	positive regulation of cardiac muscle hypertrophy	BP
GO:0048144	fibroblast proliferation	BP
GO:0048146	positive regulation of fibroblast proliferation	BP
GO:0071260	cellular response to mechanical stimulus	BP
GO:0003331	positive regulation of extracellular matrix constituent secretion	BP
GO:0014824	artery smooth muscle contraction	BP
GO:0048659	smooth muscle cell proliferation	BP
GO:0004867	serine-type endopeptidase inhibitor activity	MF
GO:0005615	extracellular space	CC
GO:0006917	induction of apoptosis	BP
GO:0051929	positive regulation of calcium ion transport via voltage-gated calcium channel activity	BP
GO:0042311	vasodilation	BP
GO:0044444	cytoplasmic part	CC
GO:0035815	positive regulation of renal sodium excretion	BP
GO:0032930	positive regulation of superoxide anion generation	BP
GO:0014873	response to muscle activity involved in regulation of muscle adaptation	BP
GO:0050663	cytokine secretion	BP
GO:0031703	type 2 angiotensin receptor binding	MF
GO:0070371	ERK1 and ERK2 cascade	BP
GO:0006883	cellular sodium ion homeostasis	BP
GO:0031702	type 1 angiotensin receptor binding	MF
GO:0048169	regulation of long-term neuronal synaptic plasticity	BP
GO:0035411	catenin import into nucleus	BP
GO:0005179	hormone activity	MF
GO:0007202	activation of phospholipase C activity	BP
GO:0004937	alpha1-adrenergic receptor activity	MF
GO:0061049	cell growth involved in cardiac muscle cell development	BP
GO:0051403	stress-activated MAPK cascade	BP

Sequence

>gi|19705570|ref|NP_602308.1| angiotensinogen precursor [Rattus norvegicus]
MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYYSKSTCAQLENPSVETLPEPTFEPVPIQAKTSPV
DEKTLRDKLVLATEKLEAEDRQRAAQVAMIANFMGFRMYKMLSEARGVASGAVLSPPALFGTLVSFYLGS
LDPTASQLQVLLGVPVKEGDCTSRLDGHKVLTALQAVQGLLVTQGGSSSQTPLLQSTVVGLFTAPGLRLK
QPFVESLGPFTPAIFPRSLDLSTDPVLAAQKINRFVQAVTGWKMNLPLEGVSTDSTLFFNTYVHFQGKMR
GFSQLTGLHEFWVDNSTSVSVPMLSGTGNFQHWSDAQNNFSVTRVPLGESVTLLLIQPQCASDLDRVEVL
VFQHDFLTWIKNPPPRAIRLTLPQLEIRGSYNLQDLLAQAKLSTLLGAEANLGKMGDTNPRVGEVLNSIL
LELQAGEEEQPTESAQQPGSPEVLDVTLSSPFLFAIYERDSGALHFLGRVDNPQNVV

Database Cross Reference

Ensembl Gene	ENSRNOT00000024917
UniGene	Rn.6319
PDB	1SMR 2WY1 2WXZ
RefSeq	NP_602308.1
Pfam	PF00079

PTID

angiotensin II

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference