dopamine D2 receptor

General Information (Source: NCBI Gene,UniProt)

Text mining Term dopamine D2 receptor
UniProt ID DRD2_MOUSE
Name D(2) dopamine receptor
Dopamine D2 receptor
Gene Names Drd2
Taxonomy Mus musculus

General annotation

Function Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (By similarity).
Subcellular location Cell membrane; Multi-pass membrane protein.

Gene Ontology

GO:0002028 regulation of sodium ion transport BP
GO:0060160 negative regulation of dopamine receptor signaling pathway BP
GO:0043278 response to morphine BP
GO:0021853 cerebral cortex GABAergic interneuron migration BP
GO:0001659 temperature homeostasis BP
GO:0035815 positive regulation of renal sodium excretion BP
GO:0007625 grooming behavior BP
GO:0002027 regulation of heart rate BP
GO:0001976 neurological system process involved in regulation of systemic arterial blood pressure BP
GO:0060134 prepulse inhibition BP
GO:0032228 regulation of synaptic transmission, GABAergic BP
GO:0007409 axonogenesis BP
GO:0043473 pigmentation BP
GO:0048149 behavioral response to ethanol BP
GO:0007608 sensory perception of smell BP
GO:0048755 branching morphogenesis of a nerve BP
GO:0030432 peristalsis BP
GO:0007195 inhibition of adenylate cyclase activity by dopamine receptor signaling pathway BP
GO:0008104 protein localization BP
GO:0008542 visual learning BP
GO:0007631 feeding behavior BP
GO:0040018 positive regulation of multicellular organism growth BP
GO:0060158 activation of phospholipase C activity by dopamine receptor signaling pathway BP
GO:0035810 positive regulation of urine volume BP
GO:0051586 positive regulation of dopamine uptake BP
GO:0008285 negative regulation of cell proliferation BP
GO:0042493 response to drug BP
GO:0014059 regulation of dopamine secretion BP
GO:0030336 negative regulation of cell migration BP
GO:0042417 dopamine metabolic process BP
GO:0021984 adenohypophysis development BP
GO:0043266 regulation of potassium ion transport BP
GO:0007628 adult walking behavior BP
GO:0060124 positive regulation of growth hormone secretion BP
GO:0002052 positive regulation of neuroblast proliferation BP
GO:0045776 negative regulation of blood pressure BP
GO:0048148 behavioral response to cocaine BP
GO:0032922 circadian regulation of gene expression BP
GO:0051967 negative regulation of synaptic transmission, glutamatergic BP
GO:0048169 regulation of long-term neuronal synaptic plasticity BP
GO:0001975 response to amphetamine BP

Sequence

>gi|148747212|ref|NP_034207.2| D(2) dopamine receptor [Mus musculus]
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTN
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPM
LYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYI
KIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELE
MEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNG
KTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000075764
ENSMUST00000114494
UniGene Mm.41970
PDB
RefSeq NP_034207.2
Pfam PF00001