corticotropin releasing factor

General Information (Source: NCBI Gene,UniProt)

Text mining Term corticotropin releasing factor
UniProt ID CRF_RAT
Name Corticotropin-releasing hormone
Corticotropin-releasing factor
Corticoliberin
CRF
Gene Names Crh
Taxonomy Rattus norvegicus

General annotation

Function This hormone from hypothalamus regulates the release of corticotropin from pituitary gland.
Subcellular location Secreted.

Gene Ontology

GO:0051461 positive regulation of corticotropin secretion BP
GO:0005737 cytoplasm CC
GO:0016101 diterpenoid metabolic process BP
GO:0042493 response to drug BP
GO:0033494 ferulate metabolic process BP
GO:0010629 negative regulation of gene expression BP
GO:0045472 response to ether BP
GO:0043025 neuronal cell body CC
GO:0010700 negative regulation of norepinephrine secretion BP
GO:0007616 long-term memory BP
GO:0008284 positive regulation of cell proliferation BP
GO:0048265 response to pain BP
GO:0035902 response to immobilization stress BP
GO:0030819 positive regulation of cAMP biosynthetic process BP
GO:0043627 response to estrogen stimulus BP
GO:0045471 response to ethanol BP
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus BP
GO:0043526 neuroprotection BP
GO:0008628 induction of apoptosis by hormones BP
GO:0042220 response to cocaine BP
GO:0001934 positive regulation of protein phosphorylation BP
GO:0005615 extracellular space CC
GO:0021854 hypothalamus development BP
GO:0060456 positive regulation of digestive system process BP
GO:0071549 cellular response to dexamethasone stimulus BP
GO:0010628 positive regulation of gene expression BP
GO:0045776 negative regulation of blood pressure BP
GO:0051412 response to corticosterone stimulus BP
GO:0007631 feeding behavior BP
GO:0014062 regulation of serotonin secretion BP
GO:0051431 corticotropin-releasing hormone receptor 2 binding MF
GO:2000854 positive regulation of corticosterone secretion BP
GO:2000987 positive regulation of behavioral fear response BP
GO:0050801 ion homeostasis BP
GO:0060548 negative regulation of cell death BP
GO:0032811 negative regulation of epinephrine secretion BP
GO:0051430 corticotropin-releasing hormone receptor 1 binding MF
GO:0070093 negative regulation of glucagon secretion BP
GO:0033685 negative regulation of luteinizing hormone secretion BP
GO:0017045 corticotropin-releasing hormone activity MF
GO:0090280 positive regulation of calcium ion import BP
GO:0008306 associative learning BP

Sequence

>gi|13591920|ref|NP_112281.1| corticoliberin precursor [Rattus norvegicus]
MRLRLLVSAGMLLVALSPCLPCRALLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNL
NRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALE
RERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000016953
UniGene Rn.10349
PDB
RefSeq NP_112281.1
Pfam PF00473