corticotropin releasing factor

General Information (Source: NCBI Gene,UniProt)

Text mining Term corticotropin releasing factor
UniProt ID CRF_RAT
Name Corticoliberin
Corticotropin-releasing factor
Corticotropin-releasing hormone
CRF
Gene Names Crh
Taxonomy Rattus norvegicus

General annotation

Function This hormone from hypothalamus regulates the release of corticotropin from pituitary gland.
Subcellular location Secreted.

Gene Ontology

GO:0010628 positive regulation of gene expression BP
GO:0045776 negative regulation of blood pressure BP
GO:0042493 response to drug BP
GO:0045472 response to ether BP
GO:0008284 positive regulation of cell proliferation BP
GO:0007616 long-term memory BP
GO:0033685 negative regulation of luteinizing hormone secretion BP
GO:0060548 negative regulation of cell death BP
GO:0010629 negative regulation of gene expression BP
GO:0043627 response to estrogen stimulus BP
GO:0017045 corticotropin-releasing hormone activity MF
GO:0048265 response to pain BP
GO:0051430 corticotropin-releasing hormone receptor 1 binding MF
GO:0001934 positive regulation of protein phosphorylation BP
GO:0051412 response to corticosterone stimulus BP
GO:0060456 positive regulation of digestive system process BP
GO:0010700 negative regulation of norepinephrine secretion BP
GO:0042220 response to cocaine BP
GO:0008306 associative learning BP
GO:0005615 extracellular space CC
GO:0071549 cellular response to dexamethasone stimulus BP
GO:0045471 response to ethanol BP
GO:0050801 ion homeostasis BP
GO:0033494 ferulate metabolic process BP
GO:0032811 negative regulation of epinephrine secretion BP
GO:0005737 cytoplasm CC
GO:0090280 positive regulation of calcium ion import BP
GO:0021854 hypothalamus development BP
GO:0043025 neuronal cell body CC
GO:0007631 feeding behavior BP
GO:0051461 positive regulation of corticotropin secretion BP
GO:0070093 negative regulation of glucagon secretion BP
GO:0035902 response to immobilization stress BP
GO:2000987 positive regulation of behavioral fear response BP
GO:0014062 regulation of serotonin secretion BP
GO:0030819 positive regulation of cAMP biosynthetic process BP
GO:0016101 diterpenoid metabolic process BP
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus BP
GO:0051431 corticotropin-releasing hormone receptor 2 binding MF
GO:2000854 positive regulation of corticosterone secretion BP
GO:0043526 neuroprotection BP
GO:0008628 induction of apoptosis by hormones BP

Sequence

>gi|13591920|ref|NP_112281.1| corticoliberin precursor [Rattus norvegicus]
MRLRLLVSAGMLLVALSPCLPCRALLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNL
NRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALE
RERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000016953
UniGene Rn.10349
PDB
RefSeq NP_112281.1
Pfam PF00473