Text mining Term | oxytocin receptor |
---|---|
UniProt ID | OXYR_RAT |
Name |
OT-R Oxytocin receptor |
Gene Names |
Oxtr
Synonyms:Otr |
Taxonomy | Rattus norvegicus |
Function |
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol- calcium second messenger system. |
---|---|
Subcellular location |
Cell membrane; Multi-pass membrane protein. |
GO:0048565 | digestive tract development | BP |
GO:0060206 | estrous cycle phase | BP |
GO:0032355 | response to estradiol stimulus | BP |
GO:0034059 | response to anoxia | BP |
GO:0017046 | peptide hormone binding | MF |
GO:0005902 | microvillus | CC |
GO:0042713 | sperm ejaculation | BP |
GO:0042220 | response to cocaine | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0004990 | oxytocin receptor activity | MF |
GO:0005913 | cell-cell adherens junction | CC |
GO:0032230 | positive regulation of synaptic transmission, GABAergic | BP |
GO:0051965 | positive regulation of synapse assembly | BP |
GO:0001975 | response to amphetamine | BP |
GO:0007565 | female pregnancy | BP |
GO:0070371 | ERK1 and ERK2 cascade | BP |
GO:0016324 | apical plasma membrane | CC |
GO:0007613 | memory | BP |
GO:0001967 | suckling behavior | BP |
GO:0042755 | eating behavior | BP |
GO:0042711 | maternal behavior | BP |
GO:0032570 | response to progesterone stimulus | BP |
GO:0010701 | positive regulation of norepinephrine secretion | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0007204 | elevation of cytosolic calcium ion concentration | BP |
GO:0005515 | protein binding | MF |
GO:0042493 | response to drug | BP |
GO:0030431 | sleep | BP |
GO:0021537 | telencephalon development | BP |
GO:0060406 | positive regulation of penile erection | BP |
GO:0016021 | integral to membrane | CC |
GO:0060137 | maternal process involved in parturition | BP |
GO:0060455 | negative regulation of gastric acid secretion | BP |
GO:0007507 | heart development | BP |
GO:0035176 | social behavior | BP |
GO:0051968 | positive regulation of synaptic transmission, glutamatergic | BP |
GO:0005000 | vasopressin receptor activity | MF |
GO:0070474 | positive regulation of uterine smooth muscle contraction | BP |
>gi|9845279|ref|NP_037003.2| oxytocin receptor [Rattus norvegicus] MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACVLLALRTTRHK HSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLA ICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYVTWITLAVYI VPVIVLAACYGLISFKIWQNLRLKTAAAAAAAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIV LAFIVCWTPFFFVQMWSVWDVNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARY LKGSRPGETSVSKKSNSSTFVLSRRSSSQRSCSQPSSA |
Ensembl Gene |
ENSRNOT00000007724 |
---|---|
UniGene |
Rn.6841 |
PDB | |
RefSeq |
NP_037003.2 |
Pfam |
PF00001 |