P18

General Information (Source: NCBI Gene,UniProt)

Text mining Term P18
UniProt ID NDKB_RAT
Name P18
NDP kinase B
NDK B
Nucleoside diphosphate kinase B
Histidine protein kinase NDKB
Gene Names Nme2
Taxonomy Rattus norvegicus

General annotation

Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Exhibits histidine protein kinase activity (By similarity).
Subcellular location Cytoplasm. Cell membrane.

Gene Ontology

GO:0005504 fatty acid binding MF
GO:0005886 plasma membrane CC
GO:0005624 membrane fraction CC
GO:0019899 enzyme binding MF
GO:0048471 perinuclear region of cytoplasm CC
GO:0019215 intermediate filament binding MF
GO:0060416 response to growth hormone stimulus BP
GO:0005524 ATP binding MF
GO:0030819 positive regulation of cAMP biosynthetic process BP
GO:0045618 positive regulation of keratinocyte differentiation BP
GO:0071398 cellular response to fatty acid BP
GO:0001726 ruffle CC
GO:0050679 positive regulation of epithelial cell proliferation BP
GO:0004673 protein histidine kinase activity MF
GO:0002762 negative regulation of myeloid leukocyte differentiation BP
GO:0006241 CTP biosynthetic process BP
GO:0030027 lamellipodium CC
GO:0034599 cellular response to oxidative stress BP
GO:0006183 GTP biosynthetic process BP
GO:0051259 protein oligomerization BP
GO:0006228 UTP biosynthetic process BP
GO:0043066 negative regulation of apoptotic process BP
GO:0010976 positive regulation of neuron projection development BP
GO:0004550 nucleoside diphosphate kinase activity MF
GO:0071333 cellular response to glucose stimulus BP
GO:0008144 drug binding MF
GO:0004674 protein serine/threonine kinase activity MF
GO:0046872 metal ion binding MF
GO:0046777 protein autophosphorylation BP

Sequence

>gi|55926145|ref|NP_114021.2| nucleoside diphosphate kinase B [Rattus norvegicus]
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFKPEELI
DYKSCAHDWVYE

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000003611
UniGene Rn.927
PDB
RefSeq NP_114021.2
Pfam PF00334