Text mining Term | P18 |
---|---|
UniProt ID | NDKB_RAT |
Name |
NDP kinase B Nucleoside diphosphate kinase B P18 NDK B Histidine protein kinase NDKB |
Gene Names |
Nme2
|
Taxonomy | Rattus norvegicus |
Function |
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Exhibits histidine protein kinase activity (By similarity). |
---|---|
Subcellular location |
Cytoplasm. Cell membrane. |
GO:0048471 | perinuclear region of cytoplasm | CC |
GO:0002762 | negative regulation of myeloid leukocyte differentiation | BP |
GO:0034599 | cellular response to oxidative stress | BP |
GO:0006241 | CTP biosynthetic process | BP |
GO:0019899 | enzyme binding | MF |
GO:0060416 | response to growth hormone stimulus | BP |
GO:0019215 | intermediate filament binding | MF |
GO:0071333 | cellular response to glucose stimulus | BP |
GO:0071398 | cellular response to fatty acid | BP |
GO:0004673 | protein histidine kinase activity | MF |
GO:0045618 | positive regulation of keratinocyte differentiation | BP |
GO:0008144 | drug binding | MF |
GO:0043066 | negative regulation of apoptotic process | BP |
GO:0005886 | plasma membrane | CC |
GO:0030819 | positive regulation of cAMP biosynthetic process | BP |
GO:0046777 | protein autophosphorylation | BP |
GO:0050679 | positive regulation of epithelial cell proliferation | BP |
GO:0006183 | GTP biosynthetic process | BP |
GO:0001726 | ruffle | CC |
GO:0030027 | lamellipodium | CC |
GO:0046872 | metal ion binding | MF |
GO:0051259 | protein oligomerization | BP |
GO:0010976 | positive regulation of neuron projection development | BP |
GO:0004674 | protein serine/threonine kinase activity | MF |
GO:0006228 | UTP biosynthetic process | BP |
GO:0005504 | fatty acid binding | MF |
GO:0004550 | nucleoside diphosphate kinase activity | MF |
GO:0005624 | membrane fraction | CC |
GO:0005524 | ATP binding | MF |
>gi|55926145|ref|NP_114021.2| nucleoside diphosphate kinase B [Rattus norvegicus] MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFKPEELI DYKSCAHDWVYE |
Ensembl Gene |
ENSRNOT00000003611 |
---|---|
UniGene |
Rn.927 |
PDB | |
RefSeq |
NP_114021.2 |
Pfam |
PF00334 |