factor A

General Information (Source: NCBI Gene,UniProt)

Text mining Term	factor A
UniProt ID	GSK3A_RAT
Name	FA GSK-3 alpha Serine/threonine-protein kinase GSK3A Factor A Glycogen synthase kinase-3 alpha
Gene Names	Gsk3a
Taxonomy	Rattus norvegicus

General annotation

Function	Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transctiption factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth (By similarity).
Subcellular location

Function

Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transctiption factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth (By similarity).

Subcellular location

Gene Ontology

GO:0016055	Wnt receptor signaling pathway	BP
GO:0034236	protein kinase A catalytic subunit binding	MF
GO:0007399	nervous system development	BP
GO:0005524	ATP binding	MF
GO:0005829	cytosol	CC
GO:0050321	tau-protein kinase activity	MF
GO:0004674	protein serine/threonine kinase activity	MF
GO:0005977	glycogen metabolic process	BP

Sequence

>gi|8393496|ref|NP_059040.1| glycogen synthase kinase-3 alpha [Rattus norvegicus]
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPS
GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE
TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT
KAKLIIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI
CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN
YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLP
PLFNFSPGELSIQPSLNAILIPPHLRSPSGPATLTSSSQALTETQTGQDWQAPDATPTLTNSS

Database Cross Reference

Ensembl Gene
UniGene	Rn.36807
PDB
RefSeq	NP_059040.1
Pfam	PF00069

PTID

factor A

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference