vanilloid receptor 1

General Information (Source: NCBI Gene,UniProt)

Text mining Term	vanilloid receptor 1
UniProt ID	TRPV1_RAT
Name	Vanilloid receptor 1 TrpV1 OTRPC1 Capsaicin receptor Osm-9-like TRP channel 1 Vanilloid receptor type 1-like Transient receptor potential cation channel subfamily V member 1
Gene Names	Trpv1
Taxonomy	Rattus norvegicus

General annotation

Function	Receptor-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. May be involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accubens by affecting AMPA receptors endocytosis.
Subcellular location	Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendritic spine membrane; Multi-pass membrane protein. Note=Mostly, but not exclusively expressed in post-synaptic dendritic spines.

Function

Receptor-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. May be involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accubens by affecting AMPA receptors endocytosis.

Subcellular location

Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendritic spine membrane; Multi-pass membrane protein. Note=Mostly, but not exclusively expressed in post-synaptic dendritic spines.

Gene Ontology

GO:0014047	glutamate secretion	BP
GO:0032591	dendritic spine membrane	CC
GO:0001774	microglial cell activation	BP
GO:0017081	chloride channel regulator activity	MF
GO:0043065	positive regulation of apoptotic process	BP
GO:0005516	calmodulin binding	MF
GO:0043025	neuronal cell body	CC
GO:0030054	cell junction	CC
GO:0005524	ATP binding	MF
GO:0060454	positive regulation of gastric acid secretion	BP
GO:0043434	response to peptide hormone stimulus	BP
GO:0005829	cytosol	CC
GO:0016021	integral to membrane	CC
GO:0009408	response to heat	BP
GO:0090212	negative regulation of establishment of blood-brain barrier	BP
GO:0007204	elevation of cytosolic calcium ion concentration	BP
GO:0045211	postsynaptic membrane	CC
GO:0009268	response to pH	BP
GO:0005262	calcium channel activity	MF
GO:0045429	positive regulation of nitric oxide biosynthetic process	BP
GO:0071502	cellular response to temperature stimulus	BP
GO:0071363	cellular response to growth factor stimulus	BP

Sequence

>gi|14010883|ref|NP_114188.1| transient receptor potential cation channel subfamily V member 1 [Rattus norvegicus]
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASPLDCPYEEGGL
ASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQRSK
KRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIE
RRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISAR
DSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNR
LLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEILSVSGGVYFFF
RGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYYTRGFQ
QMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGKNNSLPMESTPHKCRGSACKPGNSYNSL
YSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQ
RAITILDTEKSFLKCMRKAFRSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVK
RTLSFSLRSGRVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK

Database Cross Reference

Ensembl Gene	ENSRNOT00000026456 ENSRNOT00000026493
UniGene	Rn.3073
PDB	2PNN 2NYJ
RefSeq	NP_114188.1
Pfam	PF00023 PF00520

PTID

vanilloid receptor 1

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference