kit ligand

General Information (Source: NCBI Gene,UniProt)

Text mining Term	kit ligand
UniProt ID	SCF_RAT
Name	Mast cell growth factor Hematopoietic growth factor KL MGF Kit ligand SCF Stem cell factor c-Kit ligand Soluble KIT ligand sKITLG
Gene Names	Kitlg
Taxonomy	Rattus norvegicus

General annotation

Function	Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular location	Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Gene Ontology

GO:0008083	growth factor activity	MF
GO:0005737	cytoplasm	CC
GO:0007155	cell adhesion	BP
GO:0016021	integral to membrane	CC
GO:0001541	ovarian follicle development	BP
GO:0005856	cytoskeleton	CC
GO:0005886	plasma membrane	CC

Sequence

>gi|33667068|ref|NP_068615.1| kit ligand isoform 1 precursor [Rattus norvegicus]
MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPED
PGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Database Cross Reference

Ensembl Gene	ENSRNOT00000007231 ENSRNOT00000058921
UniGene	Rn.44216
PDB
RefSeq	NP_068615.1
Pfam	PF02404

PTID

kit ligand

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference