kit ligand

General Information (Source: NCBI Gene,UniProt)

Text mining Term	kit ligand
UniProt ID	SCF_MOUSE
Name	Soluble KIT ligand Mast cell growth factor Kit ligand c-Kit ligand Hematopoietic growth factor KL Stem cell factor Steel factor sKITLG SCF MGF
Gene Names	Kitlg
Taxonomy	Mus musculus

General annotation

Function	Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular location	Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Gene Ontology

GO:0008083	growth factor activity	MF
GO:0005737	cytoplasm	CC
GO:0005615	extracellular space	CC
GO:0005125	cytokine activity	MF
GO:0007281	germ cell development	BP
GO:0033026	negative regulation of mast cell apoptosis	BP
GO:0005886	plasma membrane	CC
GO:0045636	positive regulation of melanocyte differentiation	BP
GO:0070668	positive regulation of mast cell proliferation	BP
GO:0002763	positive regulation of myeloid leukocyte differentiation	BP
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	BP
GO:0007155	cell adhesion	BP
GO:0016021	integral to membrane	CC
GO:0035234	germ cell programmed cell death	BP
GO:0001755	neural crest cell migration	BP
GO:0005173	stem cell factor receptor binding	MF
GO:0046579	positive regulation of Ras protein signal transduction	BP
GO:0005856	cytoskeleton	CC

Sequence

>gi|7305267|ref|NP_038626.1| kit ligand precursor [Mus musculus]
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPED
SGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Database Cross Reference

Ensembl Gene	ENSMUST00000020129 ENSMUST00000105283
UniGene	Mm.45124
PDB	2O27 2O26
RefSeq	NP_038626.1
Pfam	PF02404

PTID

kit ligand

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference