kit ligand

General Information (Source: NCBI Gene,UniProt)

Text mining Term	kit ligand
UniProt ID	SCF_MOUSE
Name	Soluble KIT ligand SCF c-Kit ligand MGF Kit ligand Stem cell factor sKITLG Mast cell growth factor Steel factor Hematopoietic growth factor KL
Gene Names	Kitlg
Taxonomy	Mus musculus

General annotation

Function	Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular location	Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Gene Ontology

GO:0005737	cytoplasm	CC
GO:0008083	growth factor activity	MF
GO:0035234	germ cell programmed cell death	BP
GO:0045636	positive regulation of melanocyte differentiation	BP
GO:0046579	positive regulation of Ras protein signal transduction	BP
GO:0007281	germ cell development	BP
GO:0070668	positive regulation of mast cell proliferation	BP
GO:0001755	neural crest cell migration	BP
GO:0005856	cytoskeleton	CC
GO:0016021	integral to membrane	CC
GO:0005615	extracellular space	CC
GO:0007155	cell adhesion	BP
GO:0005886	plasma membrane	CC
GO:0005125	cytokine activity	MF
GO:0033026	negative regulation of mast cell apoptosis	BP
GO:0005173	stem cell factor receptor binding	MF
GO:0002763	positive regulation of myeloid leukocyte differentiation	BP
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	BP

Sequence

>gi|7305267|ref|NP_038626.1| kit ligand precursor [Mus musculus]
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPED
SGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Database Cross Reference

Ensembl Gene	ENSMUST00000105283 ENSMUST00000020129
UniGene	Mm.45124
PDB	2O26 2O27
RefSeq	NP_038626.1
Pfam	PF02404

PTID

kit ligand

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference