kit ligand

General Information (Source: NCBI Gene,UniProt)

Text mining Term	kit ligand
UniProt ID	SCF_RAT
Name	sKITLG c-Kit ligand Stem cell factor Soluble KIT ligand Mast cell growth factor Hematopoietic growth factor KL Kit ligand MGF SCF
Gene Names	Kitlg
Taxonomy	Rattus norvegicus

General annotation

Function	Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular location	Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Gene Ontology

GO:0007155	cell adhesion	BP
GO:0005737	cytoplasm	CC
GO:0001541	ovarian follicle development	BP
GO:0005886	plasma membrane	CC
GO:0005856	cytoskeleton	CC
GO:0016021	integral to membrane	CC
GO:0008083	growth factor activity	MF

Sequence

>gi|33667068|ref|NP_068615.1| kit ligand isoform 1 precursor [Rattus norvegicus]
MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPED
PGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Database Cross Reference

Ensembl Gene	ENSRNOT00000058921 ENSRNOT00000007231
UniGene	Rn.44216
PDB
RefSeq	NP_068615.1
Pfam	PF02404

PTID

kit ligand

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference