Text mining Term | kit ligand |
---|---|
UniProt ID | SCF_RAT |
Name |
sKITLG c-Kit ligand Stem cell factor Soluble KIT ligand Mast cell growth factor Hematopoietic growth factor KL Kit ligand MGF SCF |
Gene Names |
Kitlg
|
Taxonomy | Rattus norvegicus |
Function |
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
---|---|
Subcellular location |
Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity).
Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity).
Soluble KIT ligand: Secreted (By similarity). |
GO:0007155 | cell adhesion | BP |
GO:0005737 | cytoplasm | CC |
GO:0001541 | ovarian follicle development | BP |
GO:0005886 | plasma membrane | CC |
GO:0005856 | cytoskeleton | CC |
GO:0016021 | integral to membrane | CC |
GO:0008083 | growth factor activity | MF |
>gi|33667068|ref|NP_068615.1| kit ligand isoform 1 precursor [Rattus norvegicus] MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL RDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEF FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPED PGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV |
Ensembl Gene |
ENSRNOT00000058921 ENSRNOT00000007231 |
---|---|
UniGene |
Rn.44216 |
PDB | |
RefSeq |
NP_068615.1 |
Pfam |
PF02404 |