interleukin 6

General Information (Source: NCBI Gene,UniProt)

Text mining Term	interleukin 6
UniProt ID	IL6_MOUSE
Name	Interleukin HP-1 IL-6 B-cell hybridoma growth factor Interleukin-6
Gene Names	Il6
Taxonomy	Mus musculus

General annotation

Function	Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance (By similarity).
Subcellular location	Secreted.

Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance (By similarity).

Subcellular location

Secreted.

Gene Ontology

GO:0042110	T cell activation	BP
GO:0005138	interleukin-6 receptor binding	MF
GO:0009897	external side of plasma membrane	CC
GO:0045079	negative regulation of chemokine biosynthetic process	BP
GO:0046716	muscle cell homeostasis	BP
GO:0070102	interleukin-6-mediated signaling pathway	BP
GO:0060445	branching involved in salivary gland morphogenesis	BP
GO:0001781	neutrophil apoptosis	BP
GO:0005125	cytokine activity	MF
GO:0008083	growth factor activity	MF
GO:0050679	positive regulation of epithelial cell proliferation	BP
GO:0005615	extracellular space	CC
GO:0042832	defense response to protozoan	BP
GO:0046888	negative regulation of hormone secretion	BP
GO:0031018	endocrine pancreas development	BP
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	BP
GO:0070091	glucagon secretion	BP
GO:0006953	acute-phase response	BP
GO:0045630	positive regulation of T-helper 2 cell differentiation	BP

Sequence

>gi|13624311|ref|NP_112445.1| interleukin-6 precursor [Mus musculus]
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELC
NGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKAR
VLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQ
T

Database Cross Reference

Ensembl Gene	ENSMUST00000026845
UniGene	Mm.1019
PDB	2L3Y
RefSeq	NP_112445.1
Pfam	PF00489

PTID

interleukin 6

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference