interleukin 6

General Information (Source: NCBI Gene,UniProt)

Text mining Term interleukin 6
UniProt ID IL6_RAT
Name IL-6
Interleukin-6
Gene Names Il6
Taxonomy Rattus norvegicus

General annotation

Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance (By similarity).
Subcellular location Secreted.

Gene Ontology

GO:0051592 response to calcium ion BP
GO:0009408 response to heat BP
GO:0046677 response to antibiotic BP
GO:0046849 bone remodeling BP
GO:0005125 cytokine activity MF
GO:0031000 response to caffeine BP
GO:0048635 negative regulation of muscle organ development BP
GO:0005138 interleukin-6 receptor binding MF
GO:0008285 negative regulation of cell proliferation BP
GO:0007568 aging BP
GO:0045454 cell redox homeostasis BP
GO:0042517 positive regulation of tyrosine phosphorylation of Stat3 protein BP
GO:0045666 positive regulation of neuron differentiation BP
GO:0051971 positive regulation of transmission of nerve impulse BP
GO:0051602 response to electrical stimulus BP
GO:0050710 negative regulation of cytokine secretion BP
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process BP
GO:0005615 extracellular space CC
GO:0009409 response to cold BP
GO:0008360 regulation of cell shape BP
GO:0043526 neuroprotection BP
GO:0006953 acute-phase response BP
GO:0045429 positive regulation of nitric oxide biosynthetic process BP
GO:0006469 negative regulation of protein kinase activity BP
GO:0033160 positive regulation of protein import into nucleus, translocation BP
GO:0045188 regulation of circadian sleep/wake cycle, non-REM sleep BP
GO:0008083 growth factor activity MF
GO:0016049 cell growth BP
GO:0043200 response to amino acid stimulus BP
GO:0032496 response to lipopolysaccharide BP
GO:0032868 response to insulin stimulus BP
GO:0009612 response to mechanical stimulus BP
GO:0031667 response to nutrient levels BP
GO:0051897 positive regulation of protein kinase B signaling cascade BP
GO:0070374 positive regulation of ERK1 and ERK2 cascade BP
GO:0042493 response to drug BP
GO:0045721 negative regulation of gluconeogenesis BP
GO:0045740 positive regulation of DNA replication BP

Sequence

>gi|7549769|ref|NP_036721.1| interleukin-6 precursor [Rattus norvegicus]
MKFLSARDFQPVAFLGLMLLTATAFPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELC
NGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKAR
VIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEWLRTKTIQLILKALEEFLKVTMRSTRQ
T

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Rn.9873
PDB
RefSeq NP_036721.1
Pfam PF00489