survivin

General Information (Source: NCBI Gene,UniProt)

Text mining Term survivin
UniProt ID BIRC5_MOUSE
Name TIAP
Apoptosis inhibitor survivin
Apoptosis inhibitor 4
Baculoviral IAP repeat-containing protein 5
Gene Names Birc5
Taxonomy Mus musculus

General annotation

Function Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7 (By similarity).
Subcellular location Cytoplasm (By similarity). Nucleus (By similarity). Chromosome, centromere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes (By similarity).

Gene Ontology

GO:0000910 cytokinesis BP
GO:0000226 microtubule cytoskeleton organization BP
GO:0007067 mitosis BP
GO:0043524 negative regulation of neuron apoptosis BP
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process MF
GO:0005876 spindle microtubule CC
GO:0030496 midbody CC
GO:0006916 anti-apoptosis BP
GO:0042803 protein homodimerization activity MF
GO:0031021 interphase microtubule organizing center CC
GO:0000086 G2/M transition of mitotic cell cycle BP
GO:0031577 spindle checkpoint BP
GO:0051303 establishment of chromosome localization BP
GO:0031536 positive regulation of exit from mitosis BP
GO:0009790 embryo development BP
GO:0008017 microtubule binding MF
GO:0032133 chromosome passenger complex CC
GO:0005829 cytosol CC
GO:0008270 zinc ion binding MF
GO:0007059 chromosome segregation BP
GO:0048037 cofactor binding MF
GO:0031503 protein complex localization BP
GO:0005881 cytoplasmic microtubule CC
GO:0045931 positive regulation of mitotic cell cycle BP
GO:0005634 nucleus CC
GO:0005814 centriole CC
GO:0000775 chromosome, centromeric region CC

Sequence

>gi|59859890|ref|NP_001012273.1| baculoviral IAP repeat-containing protein 5 isoform 3 [Mus musculus]
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIVCMIENKD

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000081387
ENSMUST00000106322
ENSMUST00000093906
UniGene Mm.8552
PDB 1M4M
RefSeq NP_033819.1
NP_001012273.1
Pfam PF00653