Text mining Term | galectin 1 |
---|---|
UniProt ID | LEG1_RAT |
Name |
S-Lac lectin 1 Lactose-binding lectin 1 RL 14.5 Gal-1 Galectin-1 Galaptin Lectin galactoside-binding soluble 1 14 kDa lectin Beta-galactoside-binding lectin L-14-I |
Gene Names |
Lgals1
|
Taxonomy | Rattus norvegicus |
Function |
May regulate apoptosis, cell proliferation and cell differentiation. Binds beta-galactoside and a wide array of complex carbohydrates (By similarity). |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix (By similarity). |
GO:0071407 | cellular response to organic cyclic compound | BP |
GO:0030395 | lactose binding | MF |
GO:0005634 | nucleus | CC |
GO:0005737 | cytoplasm | CC |
GO:0010812 | negative regulation of cell-substrate adhesion | BP |
GO:0071333 | cellular response to glucose stimulus | BP |
GO:0005578 | proteinaceous extracellular matrix | CC |
GO:0034120 | positive regulation of erythrocyte aggregation | BP |
GO:0033555 | multicellular organismal response to stress | BP |
GO:0010977 | negative regulation of neuron projection development | BP |
GO:0016936 | galactoside binding | MF |
GO:0009986 | cell surface | CC |
GO:0001948 | glycoprotein binding | MF |
GO:0042803 | protein homodimerization activity | MF |
GO:0048678 | response to axon injury | BP |
GO:0043236 | laminin binding | MF |
GO:0042493 | response to drug | BP |
>gi|9845261|ref|NP_063969.1| galectin-1 [Rattus norvegicus] MACGLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDDGTWG TEQRETAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE |
Ensembl Gene | |
---|---|
UniGene |
Rn.57 |
PDB |
3M2M |
RefSeq |
NP_063969.1 |
Pfam |
PF00337 |