Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
ON Osteonectin Secreted protein acidic and rich in cysteine SPARC BM-40 Basement-membrane protein 40 |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0005509 | calcium ion binding | MF |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0005634 | nucleus | CC |
GO:0046686 | response to cadmium ion | BP |
GO:0001503 | ossification | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0007165 | signal transduction | BP |
GO:0009629 | response to gravity | BP |
GO:0007507 | heart development | BP |
GO:0042060 | wound healing | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0005737 | cytoplasm | CC |
GO:0051591 | response to cAMP | BP |
GO:0048839 | inner ear development | BP |
GO:0010288 | response to lead ion | BP |
GO:0030324 | lung development | BP |
GO:0005604 | basement membrane | CC |
GO:0034097 | response to cytokine stimulus | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0051592 | response to calcium ion | BP |
GO:0045471 | response to ethanol | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0005615 | extracellular space | CC |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF00050 PF10591 PF09289 |