Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
BM-40 Secreted protein acidic and rich in cysteine Basement-membrane protein 40 SPARC ON Osteonectin |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0046686 | response to cadmium ion | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0010288 | response to lead ion | BP |
GO:0051592 | response to calcium ion | BP |
GO:0005615 | extracellular space | CC |
GO:0009629 | response to gravity | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0005737 | cytoplasm | CC |
GO:0007507 | heart development | BP |
GO:0007165 | signal transduction | BP |
GO:0005509 | calcium ion binding | MF |
GO:0034097 | response to cytokine stimulus | BP |
GO:0051591 | response to cAMP | BP |
GO:0001503 | ossification | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0005604 | basement membrane | CC |
GO:0042060 | wound healing | BP |
GO:0005634 | nucleus | CC |
GO:0048839 | inner ear development | BP |
GO:0045471 | response to ethanol | BP |
GO:0030324 | lung development | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF00050 PF10591 PF09289 |