Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
SPARC ON BM-40 Osteonectin Secreted protein acidic and rich in cysteine Basement-membrane protein 40 |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0005509 | calcium ion binding | MF |
GO:0045471 | response to ethanol | BP |
GO:0030324 | lung development | BP |
GO:0005604 | basement membrane | CC |
GO:0042060 | wound healing | BP |
GO:0005737 | cytoplasm | CC |
GO:0007507 | heart development | BP |
GO:0009629 | response to gravity | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0010288 | response to lead ion | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0034097 | response to cytokine stimulus | BP |
GO:0001503 | ossification | BP |
GO:0051591 | response to cAMP | BP |
GO:0005634 | nucleus | CC |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0051592 | response to calcium ion | BP |
GO:0007165 | signal transduction | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0005615 | extracellular space | CC |
GO:0048839 | inner ear development | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF09289 PF10591 PF00050 |