p22phox

General Information (Source: NCBI Gene,UniProt)

Text mining Term p22phox
UniProt ID CY24A_RAT
Name Cytochrome b-245 light chain
p22phox
Cytochrome b(558) alpha chain
Superoxide-generating NADPH oxidase light chain subunit
Cytochrome b558 subunit alpha
p22 phagocyte B-cytochrome
p22-phox
Neutrophil cytochrome b 22 kDa polypeptide
Gene Names Cyba
Taxonomy Rattus norvegicus

General annotation

Function Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.
Subcellular location Membrane (Potential).

Gene Ontology

GO:0071333 cellular response to glucose stimulus BP
GO:0042493 response to drug BP
GO:0005794 Golgi apparatus CC
GO:0006810 transport BP
GO:0071230 cellular response to amino acid stimulus BP
GO:0020037 heme binding MF
GO:0071260 cellular response to mechanical stimulus BP
GO:0022900 electron transport chain BP
GO:0030425 dendrite CC
GO:0030307 positive regulation of cell growth BP
GO:0050665 hydrogen peroxide biosynthetic process BP
GO:0071480 cellular response to gamma radiation BP
GO:0016324 apical plasma membrane CC
GO:0042554 superoxide anion generation BP
GO:0071407 cellular response to organic cyclic compound BP
GO:0043020 NADPH oxidase complex CC
GO:0031667 response to nutrient levels BP
GO:0001938 positive regulation of endothelial cell proliferation BP
GO:0014895 smooth muscle hypertrophy BP
GO:0070555 response to interleukin-1 BP
GO:0043025 neuronal cell body CC
GO:0071356 cellular response to tumor necrosis factor BP
GO:0003106 negative regulation of glomerular filtration by angiotensin BP

Sequence

>gi|13162359|ref|NP_077074.1| cytochrome b-245 light chain [Rattus norvegicus]
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQ
KYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKE
RPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Rn.5856
PDB
RefSeq NP_077074.1
Pfam PF05038