caveolin 1

General Information (Source: NCBI Gene,UniProt)

Text mining Term caveolin 1
UniProt ID CAV1_MOUSE
Name Caveolin-1
Gene Names Cav1
Synonyms:Cav
Taxonomy Mus musculus

General annotation

Function Involved in the costimulatory signal essential for T- cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar membranes. Interacts directly with G- protein alpha subunits and can functionally regulate their activity. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.
Subcellular location Golgi apparatus membrane; Peripheral membrane protein (By similarity). Cell membrane; Peripheral membrane protein (By similarity). Membrane, caveola; Peripheral membrane protein (By similarity). Membrane raft (By similarity). Note=Colocalized with DPP4 in membrane rafts. Potential hairpin- like structure in the membrane. Membrane protein of caveolae (By similarity).

Gene Ontology

GO:0002080 acrosomal membrane CC
GO:0048554 positive regulation of metalloenzyme activity BP
GO:0051260 protein homooligomerization BP
GO:0000299 integral to membrane of membrane fraction CC
GO:0031295 T cell costimulation BP
GO:0005768 endosome CC
GO:0006641 triglyceride metabolic process BP
GO:0005938 cell cortex CC
GO:0060056 mammary gland involution BP
GO:0010524 positive regulation of calcium ion transport into cytosol BP
GO:0001960 negative regulation of cytokine-mediated signaling pathway BP
GO:0090090 negative regulation of canonical Wnt receptor signaling pathway BP
GO:0001937 negative regulation of endothelial cell proliferation BP
GO:0005783 endoplasmic reticulum CC
GO:0006816 calcium ion transport BP
GO:0030857 negative regulation of epithelial cell differentiation BP
GO:0042310 vasoconstriction BP
GO:0045019 negative regulation of nitric oxide biosynthetic process BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0006940 regulation of smooth muscle contraction BP
GO:0043627 response to estrogen stimulus BP
GO:0042632 cholesterol homeostasis BP
GO:0007595 lactation BP
GO:0000188 inactivation of MAPK activity BP
GO:0042524 negative regulation of tyrosine phosphorylation of Stat5 protein BP
GO:0048471 perinuclear region of cytoplasm CC
GO:0043234 protein complex CC
GO:0016504 peptidase activator activity MF
GO:0005887 integral to plasma membrane CC
GO:0005901 caveola CC
GO:0001666 response to hypoxia BP
GO:0019217 regulation of fatty acid metabolic process BP
GO:0001570 vasculogenesis BP
GO:0007519 skeletal muscle tissue development BP
GO:0051899 membrane depolarization BP
GO:0019915 lipid storage BP
GO:0045907 positive regulation of vasoconstriction BP
GO:0000165 MAPKKK cascade BP
GO:0051592 response to calcium ion BP
GO:0000139 Golgi membrane CC
GO:0033484 nitric oxide homeostasis BP
GO:0019861 flagellum CC

Sequence

>gi|6680854|ref|NP_031642.1| caveolin-1 isoform 1 [Mus musculus]
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE
IQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000115454
ENSMUST00000115453
ENSMUST00000115456
ENSMUST00000007799
UniGene Mm.28278
Mm.470537
PDB
RefSeq NP_031642.1
NP_001229993.1
Pfam PF01146