Text mining Term | transforming growth factor alpha |
---|---|
UniProt ID | TGFA_RAT |
Name |
Transforming growth factor alpha TGF-alpha EGF-like TGF ETGF Protransforming growth factor alpha TGF type 1 |
Gene Names |
Tgfa
|
Taxonomy | Rattus norvegicus |
Function |
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. |
---|---|
Subcellular location |
Transforming growth factor alpha: Secreted, extracellular space.
Protransforming growth factor alpha: Cell membrane; Single-pass type I membrane protein. |
GO:0005615 | extracellular space | CC |
GO:0043526 | neuroprotection | BP |
GO:0051480 | cytosolic calcium ion homeostasis | BP |
GO:0050679 | positive regulation of epithelial cell proliferation | BP |
GO:0007173 | epidermal growth factor receptor signaling pathway | BP |
GO:0005829 | cytosol | CC |
GO:0001934 | positive regulation of protein phosphorylation | BP |
GO:0045741 | positive regulation of epidermal growth factor-activated receptor activity | BP |
GO:0005887 | integral to plasma membrane | CC |
GO:0006916 | anti-apoptosis | BP |
GO:0042493 | response to drug | BP |
GO:0045840 | positive regulation of mitosis | BP |
GO:0004708 | MAP kinase kinase activity | MF |
GO:0005634 | nucleus | CC |
GO:0005154 | epidermal growth factor receptor binding | MF |
GO:0051781 | positive regulation of cell division | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0000187 | activation of MAPK activity | BP |
GO:0042060 | wound healing | BP |
GO:0008083 | growth factor activity | MF |
>gi|6981646|ref|NP_036803.1| protransforming growth factor alpha preproprotein [Rattus norvegicus] MVPAAGQLALLALGILVAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPAC VCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHE KPSALLKGRTACCHSETVV |
Ensembl Gene |
ENSRNOT00000057441 |
---|---|
UniGene |
Rn.9952 |
PDB | |
RefSeq |
NP_036803.1 |
Pfam |