Text mining Term | interleukin 2 |
---|---|
UniProt ID | IL2_RAT |
Name |
TCGF T-cell growth factor IL-2 Interleukin-2 |
Gene Names |
Il2
|
Taxonomy | Rattus norvegicus |
Function |
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells. |
---|---|
Subcellular location |
Secreted. |
GO:0045822 | negative regulation of heart contraction | BP |
GO:0007204 | elevation of cytosolic calcium ion concentration | BP |
GO:0007205 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | BP |
GO:0005125 | cytokine activity | MF |
GO:0045591 | positive regulation of regulatory T cell differentiation | BP |
GO:0006955 | immune response | BP |
GO:0030246 | carbohydrate binding | MF |
GO:0060999 | positive regulation of dendritic spine development | BP |
GO:0005615 | extracellular space | CC |
GO:0005134 | interleukin-2 receptor binding | MF |
GO:0001933 | negative regulation of protein phosphorylation | BP |
GO:0008083 | growth factor activity | MF |
GO:0043208 | glycosphingolipid binding | MF |
GO:0031851 | kappa-type opioid receptor binding | MF |
>gi|16758692|ref|NP_446288.1| interleukin-2 precursor [Rattus norvegicus] MYSMQLASCVALTLVLLVNSAPTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMMLTFKFYLPKQA TELKHLQCLENELGALQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLKGSENKFECQFDDEPATVVEFLR RWIAICQSIISTMTQ |
Ensembl Gene |
ENSRNOT00000023327 |
---|---|
UniGene |
Rn.9871 |
PDB | |
RefSeq |
NP_446288.1 |
Pfam |
PF00715 |