Text mining Term | interleukin 2 |
---|---|
UniProt ID | IL2_MOUSE |
Name |
T-cell growth factor IL-2 Interleukin-2 TCGF |
Gene Names |
Il2
|
Taxonomy | Mus musculus |
Function |
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells. |
---|---|
Subcellular location |
Secreted. |
GO:0050672 | negative regulation of lymphocyte proliferation | BP |
GO:0048304 | positive regulation of isotype switching to IgG isotypes | BP |
GO:0006955 | immune response | BP |
GO:0005125 | cytokine activity | MF |
GO:0042523 | positive regulation of tyrosine phosphorylation of Stat5 protein | BP |
GO:0005134 | interleukin-2 receptor binding | MF |
GO:0005615 | extracellular space | CC |
GO:0008083 | growth factor activity | MF |
GO:0042104 | positive regulation of activated T cell proliferation | BP |
GO:0046013 | regulation of T cell homeostatic proliferation | BP |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
GO:0050728 | negative regulation of inflammatory response | BP |
GO:0051024 | positive regulation of immunoglobulin secretion | BP |
>gi|7110653|ref|NP_032392.1| interleukin-2 precursor [Mus musculus] MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFEC QFDDESATVVDFLRRWIAFCQSIISTSPQ |
Ensembl Gene |
ENSMUST00000029275 |
---|---|
UniGene |
Mm.14190 |
PDB | |
RefSeq |
NP_032392.1 |
Pfam |
PF00715 |