Text mining Term | interleukin 3 |
---|---|
UniProt ID | IL3_MOUSE |
Name |
Mast cell growth factor Hematopoietic growth factor Interleukin-3 IL-3 Multipotential colony-stimulating factor MCGF P-cell-stimulating factor |
Gene Names |
Il3
|
Taxonomy | Mus musculus |
Function |
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
---|---|
Subcellular location |
Secreted. |
GO:0005615 | extracellular space | CC |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | BP |
GO:0002763 | positive regulation of myeloid leukocyte differentiation | BP |
GO:0033028 | myeloid cell apoptosis | BP |
GO:0045885 | positive regulation of survival gene product expression | BP |
GO:0006955 | immune response | BP |
GO:0019221 | cytokine-mediated signaling pathway | BP |
GO:0035304 | regulation of protein dephosphorylation | BP |
GO:0005135 | interleukin-3 receptor binding | MF |
GO:0033026 | negative regulation of mast cell apoptosis | BP |
GO:0006110 | regulation of glycolysis | BP |
GO:0046330 | positive regulation of JNK cascade | BP |
GO:0010507 | negative regulation of autophagy | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005125 | cytokine activity | MF |
GO:0070668 | positive regulation of mast cell proliferation | BP |
GO:0008083 | growth factor activity | MF |
>gi|31982791|ref|NP_034686.2| interleukin-3 precursor [Mus musculus] MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRN KSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLND LETVLTSRPPQPASGSVSPNRGTVEC |
Ensembl Gene |
ENSMUST00000019058 |
---|---|
UniGene |
Mm.983 |
PDB |
2L3O |
RefSeq |
NP_034686.2 |
Pfam |
PF02059 |