interleukin 1 alpha

General Information (Source: NCBI Gene,UniProt)

Text mining Term interleukin 1 alpha
UniProt ID IL1A_RAT
Name Interleukin-1 alpha
IL-1 alpha
Gene Names Il1a
Taxonomy Rattus norvegicus

General annotation

Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular location Secreted. Note=The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.

Gene Ontology

GO:0005829 cytosol CC
GO:0001666 response to hypoxia BP
GO:0031424 keratinization BP
GO:0032874 positive regulation of stress-activated MAPK cascade BP
GO:0005150 interleukin-1, Type I receptor binding MF
GO:0005615 extracellular space CC
GO:0006955 immune response BP
GO:0032755 positive regulation of interleukin-6 production BP
GO:0005125 cytokine activity MF
GO:0070374 positive regulation of ERK1 and ERK2 cascade BP
GO:0001660 fever generation BP
GO:0032496 response to lipopolysaccharide BP
GO:0005507 copper ion binding MF
GO:0009986 cell surface CC
GO:0034605 cellular response to heat BP
GO:0051930 regulation of sensory perception of pain BP
GO:0042060 wound healing BP
GO:0010193 response to ozone BP
GO:0010243 response to organic nitrogen BP
GO:0051781 positive regulation of cell division BP
GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB cascade BP
GO:0033591 response to L-ascorbic acid BP
GO:0014070 response to organic cyclic compound BP
GO:0046688 response to copper ion BP
GO:0046330 positive regulation of JNK cascade BP
GO:0010332 response to gamma radiation BP
GO:0010893 positive regulation of steroid biosynthetic process BP

Sequence

>gi|8393593|ref|NP_058715.1| interleukin-1 alpha precursor [Rattus norvegicus]
MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETSKMSTFTFKES
RVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEETIQPRSAPHSFQNNLRYKLIRIVKQEFIMND
SLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEI
PETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Rn.12300
PDB
RefSeq NP_058715.1
Pfam PF02394
PF00340