interferon gamma

General Information (Source: NCBI Gene,UniProt)

Text mining Term interferon gamma
UniProt ID IFNG_MOUSE
Name Interferon gamma
IFN-gamma
Gene Names Ifng
Taxonomy Mus musculus

General annotation

Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Subcellular location Secreted.

Gene Ontology

GO:0032760 positive regulation of tumor necrosis factor production BP
GO:0005133 interferon-gamma receptor binding MF
GO:0045080 positive regulation of chemokine biosynthetic process BP
GO:0009615 response to virus BP
GO:0002250 adaptive immune response BP
GO:0006925 inflammatory cell apoptosis BP
GO:0019882 antigen processing and presentation BP
GO:0005615 extracellular space CC
GO:0045410 positive regulation of interleukin-6 biosynthetic process BP
GO:0005125 cytokine activity MF
GO:0045084 positive regulation of interleukin-12 biosynthetic process BP
GO:0042742 defense response to bacterium BP
GO:0001781 neutrophil apoptosis BP
GO:0006959 humoral immune response BP
GO:0044130 negative regulation of growth of symbiont in host BP
GO:0032735 positive regulation of interleukin-12 production BP
GO:0030593 neutrophil chemotaxis BP
GO:0045944 positive regulation of transcription from RNA polymerase II promoter BP
GO:0071351 cellular response to interleukin-18 BP
GO:0002302 CD8-positive, alpha-beta T cell differentiation involved in immune response BP
GO:0042102 positive regulation of T cell proliferation BP
GO:0042832 defense response to protozoan BP
GO:0048304 positive regulation of isotype switching to IgG isotypes BP
GO:0045429 positive regulation of nitric oxide biosynthetic process BP
GO:0031642 negative regulation of myelination BP
GO:0050718 positive regulation of interleukin-1 beta secretion BP
GO:0030968 endoplasmic reticulum unfolded protein response BP
GO:0045348 positive regulation of MHC class II biosynthetic process BP

Sequence

>gi|33468859|ref|NP_032363.1| interferon gamma precursor [Mus musculus]
MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
LLPESSLRKRKRSRC

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000068592
UniGene Mm.240327
PDB
RefSeq NP_032363.1
Pfam PF00714