interferon gamma

General Information (Source: NCBI Gene,UniProt)

Text mining Term interferon gamma
UniProt ID IFNG_RAT
Name IFN-gamma
Interferon gamma
Gene Names Ifng
Taxonomy Rattus norvegicus

General annotation

Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Subcellular location Secreted.

Gene Ontology

GO:0042511 positive regulation of tyrosine phosphorylation of Stat1 protein BP
GO:0002026 regulation of the force of heart contraction BP
GO:0032224 positive regulation of synaptic transmission, cholinergic BP
GO:0005615 extracellular space CC
GO:0033141 positive regulation of peptidyl-serine phosphorylation of STAT protein BP
GO:0042493 response to drug BP
GO:0045785 positive regulation of cell adhesion BP
GO:0005125 cytokine activity MF
GO:0072308 negative regulation of metanephric nephron tubule epithelial cell differentiation BP
GO:0005133 interferon-gamma receptor binding MF
GO:0045666 positive regulation of neuron differentiation BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0003340 negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis BP
GO:0002053 positive regulation of mesenchymal cell proliferation BP
GO:0009615 response to virus BP

Sequence

>gi|20302055|ref|NP_620235.1| interferon gamma precursor [Rattus norvegicus]
MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQ
IISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIH
QLSPESSLRKRKRSRC

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000009919
UniGene Rn.10795
PDB
RefSeq NP_620235.1
Pfam PF00714