Text mining Term | tumor necrosis factor |
---|---|
UniProt ID | TNFA_RAT |
Name |
TNF-a Tumor necrosis factor ligand superfamily member 2 Tumor necrosis factor, soluble form Tumor necrosis factor Cachectin Tumor necrosis factor, membrane form TNF-alpha |
Gene Names |
Tnf
|
Taxonomy | Rattus norvegicus |
Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. |
---|---|
Subcellular location |
Cell membrane; Single-pass type II membrane protein (By similarity).
Tumor necrosis factor, soluble form: Secreted (By similarity). |
GO:0002037 | negative regulation of L-glutamate transport | BP |
GO:0042493 | response to drug | BP |
GO:0019722 | calcium-mediated signaling | BP |
GO:0001775 | cell activation | BP |
GO:0014823 | response to activity | BP |
GO:0050806 | positive regulation of synaptic transmission | BP |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | BP |
GO:0046325 | negative regulation of glucose import | BP |
GO:0009612 | response to mechanical stimulus | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005125 | cytokine activity | MF |
GO:0005164 | tumor necrosis factor receptor binding | MF |
GO:0043525 | positive regulation of neuron apoptosis | BP |
GO:0003009 | skeletal muscle contraction | BP |
GO:0045840 | positive regulation of mitosis | BP |
GO:0008285 | negative regulation of cell proliferation | BP |
GO:0005615 | extracellular space | CC |
>gi|6981662|ref|NP_036807.1| tumor necrosis factor [Rattus norvegicus] MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNKEEKFPNGLPL ISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQ VLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLL SAEVNLPKYLDITESGQVYFGVIAL |
Ensembl Gene |
ENSRNOT00000001110 |
---|---|
UniGene |
Rn.2275 |
PDB | |
RefSeq |
NP_036807.1 |
Pfam |
PF00229 |