Text mining Term | thioredoxin reductase |
---|---|
UniProt ID | PRDX2_MOUSE |
Name |
Thioredoxin-dependent peroxide reductase 1 Thioredoxin peroxidase 1 Thiol-specific antioxidant protein TSA Peroxiredoxin-2 |
Gene Names |
Prdx2
|
Taxonomy | Mus musculus |
Function |
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |
---|---|
Subcellular location |
Cytoplasm. |
GO:0008430 | selenium binding | MF |
GO:2000378 | negative regulation of reactive oxygen species metabolic process | BP |
GO:0008379 | thioredoxin peroxidase activity | MF |
GO:0030194 | positive regulation of blood coagulation | BP |
GO:0048872 | homeostasis of number of cells | BP |
GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway | BP |
GO:0019430 | removal of superoxide radicals | BP |
GO:0042744 | hydrogen peroxide catabolic process | BP |
GO:0005515 | protein binding | MF |
GO:0000187 | activation of MAPK activity | BP |
GO:0002536 | respiratory burst involved in inflammatory response | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0010310 | regulation of hydrogen peroxide metabolic process | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0005739 | mitochondrion | CC |
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | BP |
GO:0048538 | thymus development | BP |
GO:0042098 | T cell proliferation | BP |
GO:0045581 | negative regulation of T cell differentiation | BP |
>gi|148747558|ref|NP_035693.3| peroxiredoxin-2 [Mus musculus] MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Ensembl Gene |
ENSMUST00000164807 ENSMUST00000109734 ENSMUST00000005292 ENSMUST00000109733 |
---|---|
UniGene |
Mm.347009 Mm.393373 |
PDB | |
RefSeq |
NP_035693.3 |
Pfam |
PF00578 PF10417 |