thioredoxin reductase

General Information (Source: NCBI Gene,UniProt)

Text mining Term	thioredoxin reductase
UniProt ID	PRDX2_MOUSE
Name	Thioredoxin peroxidase 1 Thiol-specific antioxidant protein Peroxiredoxin-2 Thioredoxin-dependent peroxide reductase 1 TSA
Gene Names	Prdx2
Taxonomy	Mus musculus

General annotation

Function	Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Subcellular location	Cytoplasm.

Function

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

Subcellular location

Cytoplasm.

Gene Ontology

GO:0042098	T cell proliferation	BP
GO:0032088	negative regulation of NF-kappaB transcription factor activity	BP
GO:0008430	selenium binding	MF
GO:0008379	thioredoxin peroxidase activity	MF
GO:0042744	hydrogen peroxide catabolic process	BP
GO:0045581	negative regulation of T cell differentiation	BP
GO:0019430	removal of superoxide radicals	BP
GO:0030194	positive regulation of blood coagulation	BP
GO:2000378	negative regulation of reactive oxygen species metabolic process	BP
GO:0048872	homeostasis of number of cells	BP
GO:0005739	mitochondrion	CC
GO:0002536	respiratory burst involved in inflammatory response	BP
GO:0005515	protein binding	MF
GO:0010310	regulation of hydrogen peroxide metabolic process	BP
GO:0000187	activation of MAPK activity	BP
GO:0006916	anti-apoptosis	BP
GO:0032496	response to lipopolysaccharide	BP
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	BP
GO:0048538	thymus development	BP

Sequence

>gi|148747558|ref|NP_035693.3| peroxiredoxin-2 [Mus musculus]
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC
EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQ
ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Database Cross Reference

Ensembl Gene	ENSMUST00000109733 ENSMUST00000164807 ENSMUST00000109734 ENSMUST00000005292
UniGene	Mm.347009 Mm.393373
PDB
RefSeq	NP_035693.3
Pfam	PF10417 PF00578

PTID

thioredoxin reductase

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference