glyceraldehyde 3 phosphate dehydrogenase

General Information (Source: NCBI Gene,UniProt)

Text mining Term	glyceraldehyde 3 phosphate dehydrogenase
UniProt ID	G3P_MOUSE
Name	Peptidyl-cysteine S-nitrosylase GAPDH GAPDH Glyceraldehyde-3-phosphate dehydrogenase
Gene Names	Gapdh Synonyms:Gapd
Taxonomy	Mus musculus

General annotation

Function	Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3- phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Also participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S- nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity).
Subcellular location	Cytoplasm, cytosol (By similarity). Nucleus (By similarity). Note=Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity).

Function

Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3- phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Also participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S- nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity).

Subcellular location

Cytoplasm, cytosol (By similarity). Nucleus (By similarity). Note=Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity).

Gene Ontology

GO:0035605	peptidyl-cysteine S-nitrosylase activity	MF
GO:0051402	neuron apoptosis	BP
GO:0051287	NAD binding	MF
GO:0005515	protein binding	MF
GO:0050661	NADP binding	MF
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	MF
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	BP
GO:0005634	nucleus	CC
GO:0050821	protein stabilization	BP
GO:0006096	glycolysis	BP
GO:0005829	cytosol	CC

Sequence

>gi|6679937|ref|NP_032110.1| glyceraldehyde-3-phosphate dehydrogenase [Mus musculus]
MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGK
PITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDN
SLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTG
AAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVV
SCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE

Database Cross Reference

Ensembl Gene	ENSMUST00000117757 ENSMUST00000109595 ENSMUST00000118875 ENSMUST00000113842 ENSMUST00000109588 ENSMUST00000110458 ENSMUST00000104945 ENSMUST00000098560
UniGene	Mm.458138 Mm.414470 Mm.392480 Mm.343110 Mm.304088 Mm.392463 Mm.309092 Mm.458416 Mm.317779
PDB
RefSeq	XP_001476757.1 NP_032110.1
Pfam	PF00044 PF02800

PTID

glyceraldehyde 3 phosphate dehydrogenase

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference