Text mining Term | succinate dehydrogenase (protein family or complex) |
---|---|
UniProt ID | SDF2B_DROSI |
Name |
Succinate dehydrogenase subunit 5-B, mitochondrial SDH assembly factor 2-B Succinate dehydrogenase assembly factor 2-B, mitochondrial |
Gene Names |
|
Taxonomy | Drosophila simulans |
Function |
Required for insertion of FAD cofactor into Scs-fp, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains Scs-fp in a conformation that is susceptible to autocatalytic FAD attachment (By similarity). |
---|---|
Subcellular location |
Mitochondrion (By similarity). |
GO:0006121 | mitochondrial electron transport, succinate to ubiquinone | BP |
GO:0018293 | protein-FAD linkage | BP |
GO:0005739 | mitochondrion | CC |
>gi|257096764|sp|B4QID8.1|SDF2B_DROSI RecName: Full=Succinate dehydrogenase assembly factor 2-B, mitochondrial; Short=SDH assembly factor 2-B; AltName: Full=Succinate dehydrogenase subunit 5-B, mitochondrial; Flags: Precursor MLRQFIVSTVGRRLQLPMMAQSRLASNLDKTEYTTPGEIVDYDDPPHLPVPEYPVRPDEPLEIRKQRLLY QSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKE HVKNHEKVQRIRQPDL |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq |
XP_002080913.1 |
Pfam |
PF03937 |