Text mining Term | ubiquinol cytochrome c reductase (protein family or complex) |
---|---|
UniProt ID | CYB_BRANA |
Name |
Complex III subunit 3 Cytochrome b-c1 complex subunit 3 Complex III subunit III Ubiquinol-cytochrome-c reductase complex cytochrome b subunit Cytochrome b |
Gene Names |
|
Taxonomy | Brassica napus |
Function |
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis (By similarity). |
---|---|
Subcellular location |
Mitochondrion inner membrane; Multi-pass membrane protein (By similarity). |
GO:0009055 | electron carrier activity | MF |
GO:0005743 | mitochondrial inner membrane | CC |
GO:0016021 | integral to membrane | CC |
GO:0016491 | oxidoreductase activity | MF |
GO:0070469 | respiratory chain | CC |
GO:0006810 | transport | BP |
GO:0046872 | metal ion binding | MF |
GO:0022904 | respiratory electron transport chain | BP |
>gi|1345904|sp|P49390.1|CYB_BRANA RecName: Full=Cytochrome b; AltName: Full=Complex III subunit 3; AltName: Full=Complex III subunit III; AltName: Full=Cytochrome b-c1 complex subunit 3; AltName: Full=Ubiquinol-cytochrome-c reductase complex cytochrome b subunit MTIRNQRFSLLKQPISSTLNQHLVDYPTPSNLSYWWGFGPLAGICLVIQIVTGVFLAMHYTPHVDLAFNS VEHIMRDVEGGWLLRYMHA |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |