Text mining Term | protein C |
---|---|
UniProt ID | D5MAH2_PEA |
Name |
PsaC 1 PSI-C 1 Photosystem I iron-sulfur center 1 Photosystem I subunit VII 1 9 kDa polypeptide 1 |
Gene Names |
psaC
Synonyms:psaC1 |
Taxonomy | Pisum sativum |
Function |
Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with psaA/B/D and helps assemble the protein into the PSI complex. Required for binding of psaD and psaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn (By similarity). |
---|---|
Subcellular location |
Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Stromal side (By similarity). |
GO:0006810 | transport | BP |
GO:0009522 | photosystem I | CC |
GO:0009535 | chloroplast thylakoid membrane | CC |
GO:0046872 | metal ion binding | MF |
GO:0009055 | electron carrier activity | MF |
GO:0051539 | 4 iron, 4 sulfur cluster binding | MF |
GO:0009773 | photosynthetic electron transport in photosystem I | BP |
>gi|295136986|ref|YP_003587533.1| photosystem I protein C [Pisum sativum] MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLW HETTRSMGLAY |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq |
YP_003587533.1 |
Pfam |
PF12838 |