Text mining Term | ATPases |
---|---|
UniProt ID | ATP8_CERCA |
Name |
A6L ATP synthase protein 8 F-ATPase subunit 8 |
Gene Names |
|
Taxonomy | Ceratitis capitata |
Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). |
---|---|
Subcellular location |
Mitochondrion membrane; Single-pass membrane protein. |
GO:0015078 | hydrogen ion transmembrane transporter activity | MF |
GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | CC |
GO:0016021 | integral to membrane | CC |
GO:0015986 | ATP synthesis coupled proton transport | BP |
>gi|12585179|sp|Q9XMN9.1|ATP8_CERCA RecName: Full=ATP synthase protein 8; AltName: Full=A6L; AltName: Full=F-ATPase subunit 8 MPQMAPIGWLSLFIIFSLTFILFSMMNYYSTIPQSPKSQILKKSQTNSMNWKW |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq |
NP_008650.1 |
Pfam |
PF00895 |