Text mining Term | chitinase |
---|---|
UniProt ID | IDGF_HELVI |
Name |
Imaginal disk growth factor protein Chitinase-like protein |
Gene Names |
|
Taxonomy | Heliothis virescens |
Function |
Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex (By similarity). |
---|---|
Subcellular location |
Secreted (By similarity). Note=Secreted in hemolymph (By similarity). It is probably transported to target tissues via hemolymph (By similarity). |
GO:0007275 | multicellular organismal development | BP |
GO:0005576 | extracellular region | CC |
>gi|292630790|sp|P86357.1|IDGF_HELVI RecName: Full=Chitinase-like protein; AltName: Full=Imaginal disk growth factor protein VLLSVGGDADTESPEKKNLGGVSIVDLSMDDFRGLLT |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |