Text mining Term | F18 |
---|---|
UniProt ID | Q37819_9CUCU |
Name |
Cytochrome c oxidase subunit 1 |
Gene Names |
COI
|
Taxonomy | Hegeter politus |
Function |
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity). |
---|---|
Subcellular location |
Mitochondrion inner membrane; Multi-pass membrane protein (By similarity). |
GO:0016021 | integral to membrane | CC |
GO:0022900 | electron transport chain | BP |
GO:0004129 | cytochrome-c oxidase activity | MF |
GO:0009055 | electron carrier activity | MF |
GO:0020037 | heme binding | MF |
GO:0005743 | mitochondrial inner membrane | CC |
GO:0009060 | aerobic respiration | BP |
GO:0070469 | respiratory chain | CC |
>gi|2463142|emb|CAB07882.1| cytochrome oxidase [Hegeter politus] HGTQLNYSPSLLWALGFVFLFTVGGLTGVVLANSSIDIMLHDTYYVVAHFHYVLSMGAVFAIFGG |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF00115 |