G protein

General Information (Source: NCBI Gene,UniProt)

Text mining Term	G protein
UniProt ID	RGS_DROME
Name	RGS Loco Regulator of G-protein signaling loco Locomotion defects protein
Gene Names	loco
Taxonomy	Drosophila melanogaster

General annotation

Function	Acts as a regulator of G protein signaling (RGS). Modulates G protein alpha subunits nucleotide exchange and hydrolysis activities by functioning either as a GTPase-activating protein (GAP), thereby driving G protein alpha subunits into their inactive GDP-bound form, or as a GDP-dissociation inhibitor (GDI). Confers GDI and GAP activities on G(i) alpha subunits G-ialpha65A. Confers GAP activity on G(o) alpha subunit GNAI0 and G(i) alpha subunits. Involved in the dorsal-ventral axis formation of the egg. Acts as a G-protein signaling for glial cell differentiation during embryogenesis; G-ialpha65A, G-oalpha47A and the G-protein coupled receptor, moody, are required in the surface glia to achieve effective insulation of the nerve cord. May be essential for nurse cell dumping during oogenesis. Required in neuroblast asymmetrical cell division. Plays a role in stress resistance and life span control.
Subcellular location	Cytoplasm. Cell membrane. Apical cell membrane. Note=Recruited from the cytosol to the plasma membrane by the G(i) alpha subunit. Colocalizes with moody at the plasma membrane. Localizes as a crescent to the apical cortex in interphase and forms an apical crescent and segregates into the apical daughter cell at telophase. Colocalizes with G-ialpha65A and raps/pins at the apical cortex throughout mitosis.

Function

Acts as a regulator of G protein signaling (RGS). Modulates G protein alpha subunits nucleotide exchange and hydrolysis activities by functioning either as a GTPase-activating protein (GAP), thereby driving G protein alpha subunits into their inactive GDP-bound form, or as a GDP-dissociation inhibitor (GDI). Confers GDI and GAP activities on G(i) alpha subunits G-ialpha65A. Confers GAP activity on G(o) alpha subunit GNAI0 and G(i) alpha subunits. Involved in the dorsal-ventral axis formation of the egg. Acts as a G-protein signaling for glial cell differentiation during embryogenesis; G-ialpha65A, G-oalpha47A and the G-protein coupled receptor, moody, are required in the surface glia to achieve effective insulation of the nerve cord. May be essential for nurse cell dumping during oogenesis. Required in neuroblast asymmetrical cell division. Plays a role in stress resistance and life span control.

Subcellular location

Cytoplasm. Cell membrane. Apical cell membrane. Note=Recruited from the cytosol to the plasma membrane by the G(i) alpha subunit. Colocalizes with moody at the plasma membrane. Localizes as a crescent to the apical cortex in interphase and forms an apical crescent and segregates into the apical daughter cell at telophase. Colocalizes with G-ialpha65A and raps/pins at the apical cortex throughout mitosis.

Gene Ontology

GO:0032291	axon ensheathment in central nervous system	BP
GO:0007310	oocyte dorsal/ventral axis specification	BP
GO:0008105	asymmetric protein localization	BP
GO:0005096	GTPase activator activity	MF
GO:0055059	asymmetric neuroblast division	BP
GO:0045179	apical cortex	CC
GO:0009408	response to heat	BP
GO:0006979	response to oxidative stress	BP
GO:0005092	GDP-dissociation inhibitor activity	MF
GO:0016324	apical plasma membrane	CC
GO:0007049	cell cycle	BP
GO:0001965	G-protein alpha-subunit binding	MF
GO:0019991	septate junction assembly	BP
GO:0000578	embryonic axis specification	BP
GO:0007186	G-protein coupled receptor signaling pathway	BP
GO:0042594	response to starvation	BP
GO:0008069	dorsal/ventral axis specification, ovarian follicular epithelium	BP
GO:0060857	establishment of glial blood-brain barrier	BP
GO:0005057	receptor signaling protein activity	MF
GO:0007419	ventral cord development	BP
GO:0030866	cortical actin cytoskeleton organization	BP
GO:0014045	establishment of endothelial blood-brain barrier	BP
GO:0009786	regulation of asymmetric cell division	BP
GO:0007303	cytoplasmic transport, nurse cell to oocyte	BP
GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	BP

Sequence

>gi|74947778|sp|Q9VCX1.2|RGS_DROME RecName: Full=Regulator of G-protein signaling loco; Short=RGS; AltName: Full=Locomotion defects protein; Short=Loco
MHHHHPPLPITGASGSTAVGTGAAAAEDASPAANSGPAPISTSTTPSGSNSQQHQRRRKKRANYNYNGIR
TVEVRRGYNGFGFTISGQQPCRLSCIISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSI
RMQIAENYYSDSSDEENAHATLRGQLLAASLRHKPRFLHHKAKLHRLRNSPQKKLNPPEAVEPHKSKSSP
DHPTLKPVLEDPPLTANLSKAADVANVSAMVRAVGSAALECRVIVGYLGTIEMPKQISHSSKLQTVRSCI
RKLRQEKRQPTIVLMCITPDSLSLQSSSGGVLATYSSARLNFVSSSSESENRFFGLVTSAVHNTQIEEEY
EPSAGSAAAAGHISISHSCHVFVIDTKLIEHAQHLQRAHEFRLQCTRDPISNLCLEFPNNSEYVVNLVRS
MYTMRILPPASRSHQADYEAGAGAAAAGGAVAAAHSPQPSNHSEISTTTSNSDSGIGFNNDCTNISDRIL
VVDFLAAGAGAAAAAHAGPPTYPAPARPLGIVGIPDNRLTVRAMPDHSALLRSPPASSSLRRPNLLASFN
LIQSPATNLTSTRSCDDVLNLFVDDSPRTLAAVASMDDISLHSAAPSLDEGHTFAHPACVPRKMRRSLAL
ETPTTPHKLSAQVFGQPGSRHSLGFEAIDSVQSSVSGACMDQTMDTWASLQNLHKSHKDRTSMSASSSSH
CLLEATNSEPDLGNRALPANASPFRRAWGQSSFRTPRSDKVAKEQQQLGQSSPVRRTASMNASDNDMYIK
TLMLDSDLKSSRSQHQLSLLQVPKVLTTPAPPSAITASVAAEGAAQDHGCPSSWAGSFERMLQDAAGMQT
FSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAA
PDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCVEAEQKNQPLPYSGLDLDELLKTNFHLGAFSKLKKSAS
NAEDRRRKSLLPWHRKTRSKSRDRTEIMADMQHALMPAPPVPQNAPLTSASLKLVCGQNSLSDLHSSRSS
LSSFDAGTATGGQGASTESVYSLCRVILTDGATTIVQTRPGETVGELVERLLEKRNLVYPYYDIVFQGST
KSIDVQQPSQILAGKEVVIERRVAFKLDLPDPKVISVKSKPKKQLHEVIRPILSKYNYKMEQVQVIMRDT
QVPIDLNQPVTMADGQRLRIVMVNSDFQVGGGSSMPPKQSKPMKPLPQGHLDELTNKVFNELLASKADAA
ASEKSRPVDLCSMKSNEAPSETSSLFERMRRQQRDGGNIPASKLPKLKKKSTSSSQQSEEAATTQAVADP
KKPIIAKLKAGVKLQVTERVAEHQDELLEGLKRAQLARLEDQRGTEINFDLPDFLKNKENLSAAVSKLRK
VRASLSPVSKVPATPTEIPQPAPRLSITRSQQPVSPMKVDQEPETDLPAATQDQTEFAKAPPPLPPKPKV
LPIKPSNWGVAQPTGNYCNKYSPSKQVPTSPKEASKPGTFASKIPLDLGRKSLEEAGSRCAYLDEPSSSF
V

Database Cross Reference

Ensembl Gene
UniGene	Dm.3231
PDB
RefSeq	NP_732773.1
Pfam	PF00595 PF00615 PF02196

PTID

G protein

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference