Text mining Term | protein a |
---|---|
UniProt ID | MT2_TRIRP |
Name |
Metallothionein-like protein A Metallothionein-like protein 2 MT-A |
Gene Names |
MT1A
|
Taxonomy | Trifolium repens |
Function |
Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
---|---|
Subcellular location |
GO:0046872 | metal ion binding | MF |
>gi|1171041|sp|P43398.1|MT2_TRIRP RecName: Full=Metallothionein-like protein 2; AltName: Full=Metallothionein-like protein A; Short=MT-A MSCCGGNCGCGSACKCGNGCGGCKMNADLSYTESTTTETIVMGVGSAKAQFEGAEMGAESGGCKCGANCT CDPCTCK |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF01439 |