| Text mining Term | protein a |
|---|---|
| UniProt ID | MT2_TRIRP |
| Name |
MT-A Metallothionein-like protein 2 Metallothionein-like protein A |
| Gene Names |
MT1A
|
| Taxonomy | Trifolium repens |
| Function |
Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
|---|---|
| Subcellular location |
| GO:0046872 | metal ion binding | MF |
>gi|1171041|sp|P43398.1|MT2_TRIRP RecName: Full=Metallothionein-like protein 2; AltName: Full=Metallothionein-like protein A; Short=MT-A MSCCGGNCGCGSACKCGNGCGGCKMNADLSYTESTTTETIVMGVGSAKAQFEGAEMGAESGGCKCGANCT CDPCTCK |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF01439 |