Text mining Term | interleukin 6 |
---|---|
UniProt ID | IL6_MOUSE |
Name |
Interleukin-6 IL-6 Interleukin HP-1 B-cell hybridoma growth factor |
Gene Names |
Il6
|
Taxonomy | Mus musculus |
Function |
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0060445 | branching involved in salivary gland morphogenesis | BP |
GO:0006953 | acute-phase response | BP |
GO:0050679 | positive regulation of epithelial cell proliferation | BP |
GO:0042832 | defense response to protozoan | BP |
GO:0046716 | muscle cell homeostasis | BP |
GO:0046888 | negative regulation of hormone secretion | BP |
GO:0060664 | epithelial cell proliferation involved in salivary gland morphogenesis | BP |
GO:0005615 | extracellular space | CC |
GO:0070102 | interleukin-6-mediated signaling pathway | BP |
GO:0070091 | glucagon secretion | BP |
GO:0001781 | neutrophil apoptosis | BP |
GO:0008083 | growth factor activity | MF |
GO:0005125 | cytokine activity | MF |
GO:0005138 | interleukin-6 receptor binding | MF |
GO:0031018 | endocrine pancreas development | BP |
GO:0009897 | external side of plasma membrane | CC |
GO:0045630 | positive regulation of T-helper 2 cell differentiation | BP |
GO:0042110 | T cell activation | BP |
GO:0045079 | negative regulation of chemokine biosynthetic process | BP |
>gi|13624311|ref|NP_112445.1| interleukin-6 precursor [Mus musculus] MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELC NGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKAR VLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQ T |
Ensembl Gene |
ENSMUST00000026845 |
---|---|
UniGene |
Mm.1019 |
PDB |
2L3Y |
RefSeq |
NP_112445.1 |
Pfam |
PF00489 |