Text mining Term | alpha 1 acid glycoprotein |
---|---|
UniProt ID | A1AG_RAT |
Name |
OMD Alpha-1-acid glycoprotein Orosomucoid |
Gene Names |
Orm1
|
Taxonomy | Rattus norvegicus |
Function |
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain (By similarity). Appears to function in modulating the activity of the immune system during the acute-phase reaction. |
---|---|
Subcellular location |
Secreted (By similarity). |
GO:0002682 | regulation of immune system process | BP |
GO:0033197 | response to vitamin E | BP |
GO:0008144 | drug binding | MF |
GO:0071378 | cellular response to growth hormone stimulus | BP |
GO:0042493 | response to drug | BP |
GO:0006953 | acute-phase response | BP |
GO:0005615 | extracellular space | CC |
GO:0002438 | acute inflammatory response to antigenic stimulus | BP |
GO:0031100 | organ regeneration | BP |
GO:0014070 | response to organic cyclic compound | BP |
GO:0071385 | cellular response to glucocorticoid stimulus | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0006810 | transport | BP |
GO:0002439 | chronic inflammatory response to antigenic stimulus | BP |
GO:0071300 | cellular response to retinoic acid | BP |
>gi|16757980|ref|NP_445740.1| alpha-1-acid glycoprotein precursor [Rattus norvegicus] MALHMVLVVLSLLPLLEAQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYL TPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENR GLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
Ensembl Gene |
ENSRNOT00000010454 |
---|---|
UniGene |
Rn.10295 |
PDB | |
RefSeq |
NP_445740.1 |
Pfam |
PF00061 |