Text mining Term | ribosomal protein S12 |
---|---|
UniProt ID | Q2LQA5_SYNAS |
Name |
30S ribosomal protein S12 |
Gene Names |
|
Taxonomy | Syntrophus aciditrophicus SB |
Function |
Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).
With S4 and S5 plays an important role in translational accuracy (By similarity). |
---|---|
Subcellular location |
GO:0006412 | translation | BP |
GO:0000049 | tRNA binding | MF |
GO:0015935 | small ribosomal subunit | CC |
GO:0019843 | rRNA binding | MF |
GO:0003735 | structural constituent of ribosome | MF |
>gi|85858142|ref|YP_460344.1| ribosomal protein S12 [Syntrophus aciditrophicus SB] MLVRGGRVKDLPGVRYHIVRGTLDAVGVQDRKQGRSKYGAKKPS |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq |
YP_460344.1 |
Pfam |
PF00164 |