tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

Text mining Term	tumor suppressor p53
UniProt ID	P53_RAT
Name	Tumor suppressor p53 Cellular tumor antigen p53
Gene Names	Tp53 Synonyms:P53
Taxonomy	Rattus norvegicus

General annotation

Function	Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).
Subcellular location	Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Note=Interaction with BANP promotes nuclear localization (By similarity).

Function

Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).

Subcellular location

Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Note=Interaction with BANP promotes nuclear localization (By similarity).

Gene Ontology

GO:0005625	soluble fraction	CC
GO:0005667	transcription factor complex	CC
GO:0042060	wound healing	BP
GO:0006979	response to oxidative stress	BP
GO:0003682	chromatin binding	MF
GO:0000739	DNA strand annealing activity	MF
GO:0034097	response to cytokine stimulus	BP
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	BP
GO:0030308	negative regulation of cell growth	BP
GO:0051453	regulation of intracellular pH	BP
GO:0010165	response to X-ray	BP
GO:0010332	response to gamma radiation	BP
GO:0048662	negative regulation of smooth muscle cell proliferation	BP
GO:0006289	nucleotide-excision repair	BP
GO:0043565	sequence-specific DNA binding	MF
GO:0031065	positive regulation of histone deacetylation	BP
GO:0032526	response to retinoic acid	BP
GO:0003684	damaged DNA binding	MF
GO:0034644	cellular response to UV	BP
GO:0007049	cell cycle	BP
GO:0002039	p53 binding	MF
GO:0008635	activation of caspase activity by cytochrome c	BP
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	BP
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	BP
GO:0044212	transcription regulatory region DNA binding	MF
GO:0002687	positive regulation of leukocyte migration	BP
GO:0010038	response to metal ion	BP
GO:0007569	cell aging	BP
GO:0005730	nucleolus	CC
GO:0005739	mitochondrion	CC
GO:0051262	protein tetramerization	BP
GO:0007275	multicellular organismal development	BP
GO:0042493	response to drug	BP
GO:0005829	cytosol	CC
GO:0043200	response to amino acid stimulus	BP
GO:0031000	response to caffeine	BP
GO:0008022	protein C-terminus binding	MF
GO:0006351	transcription, DNA-dependent	BP
GO:0071417	cellular response to organic nitrogen	BP
GO:0005657	replication fork	CC
GO:0045787	positive regulation of cell cycle	BP
GO:0031625	ubiquitin protein ligase binding	MF
GO:0000785	chromatin	CC
GO:2000279	negative regulation of DNA biosynthetic process	BP
GO:0005524	ATP binding	MF
GO:0005783	endoplasmic reticulum	CC
GO:0043525	positive regulation of neuron apoptosis	BP
GO:0042771	DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis	BP
GO:0005507	copper ion binding	MF
GO:0055093	response to hyperoxia	BP
GO:0003700	sequence-specific DNA binding transcription factor activity	MF
GO:0031571	mitotic cell cycle G1/S transition DNA damage checkpoint	BP
GO:0033552	response to vitamin B3	BP

Sequence

>gi|189083686|ref|NP_112251.2| cellular tumor antigen p53 [Rattus norvegicus]
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAA
QEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCP
VQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTF
RHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDR
RTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKD
ARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

Database Cross Reference

Ensembl Gene	ENSRNOT00000046490
UniGene	Rn.54443
PDB
RefSeq	NP_112251.2
Pfam	PF08563 PF00870 PF07710

PTID

tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference